KEGG   Homo sapiens (human): 408263Help
Entry
408263            CDS       T01001                                 

Gene name
FNDC9, C5orf40
Definition
(RefSeq) fibronectin type III domain containing 9
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: fn3 Pur_ac_phosph_N
Motif
Other DBs
NCBI-GeneID: 408263
NCBI-ProteinID: NP_001001343
HGNC: 33547
Ensembl: ENSG00000172568
Vega: OTTHUMG00000130248
Pharos: Q8TBE3(Tdark)
UniProt: Q8TBE3
Position
5q33.3
AA seq 224 aa AA seqDB search
MNIEVGNISYTGAIISWSSSEPCLEDYYHIMYRPNWNSIFSGYLRYSFHHEEKVPRTISS
VVLEHLAPSTLYFLCISCKKAAFPYRHYCTMFHTLDKSPLAPGSSLVDPQISLWVLMAIL
LACFTAVLAFICLQFWCVRCHEPRWSYRAGHMEEANGLVRWPEEAPDLGQREEDLQGLPL
VEMPRKNSRDGAELDPEANQDAPDAGALQRGGGDPPAILPHCGE
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgaacatcgaggtggggaacatttcttatacaggagccatcatctcctggtcgtcctcg
gagccctgcctggaggactattaccatattatgtacaggcccaactggaacagcatcttc
tctggctatcttcgctacagcttccaccacgaggagaaggtgcctcgaacgatcagctcc
gtggtgctggaacatcttgccccttccactctctacttcctgtgcatcagctgtaagaag
gctgccttcccttacaggcactactgcaccatgttccacaccctggataagagtccgctg
gctcctggaagctccctggtagacccccagatctccctttgggtgctgatggccattctg
ctggcctgcttcacagccgtcttggccttcatctgcctccagttctggtgtgtccgttgc
catgagccgcgatggtcttacagggctggccacatggaggaggccaatgggttggtgaga
tggccagaggaggccccggatcttggtcagagggaggaagacctgcaggggctccccctg
gtggaaatgccacgcaagaactccagagatggagctgaactggatcccgaagccaaccag
gatgcccctgatgcgggtgccttacagagggggggtggtgacccacccgctatactgcct
cattgtggggaatga

DBGET integrated database retrieval system