KEGG   Homo sapiens (human): 4085Help
Entry
4085              CDS       T01001                                 

Gene name
MAD2L1, HSMAD2, MAD2
Definition
(RefSeq) mitotic arrest deficient 2 like 1
  KO
K02537  mitotic spindle assembly checkpoint protein MAD2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04110  Cell cycle
hsa04114  Oocyte meiosis
hsa04914  Progesterone-mediated oocyte maturation
hsa05166  Human T-cell leukemia virus 1 infection
Network
nt06130  Cell cycle (viruses)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06230  Cell cycle G1/S
  Element
N00222  HTLV-1 Tax to spindle assembly checkpoint signaling
N00493  Spindle assembly checkpoint signaling
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    4085 (MAD2L1)
   04114 Oocyte meiosis
    4085 (MAD2L1)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    4085 (MAD2L1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    4085 (MAD2L1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    4085 (MAD2L1)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Core SAC proteins
     4085 (MAD2L1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HORMA ATG101 ATG13 bacHORMA_2
Motif
Other DBs
NCBI-GeneID: 4085
NCBI-ProteinID: NP_002349
OMIM: 601467
HGNC: 6763
Ensembl: ENSG00000164109
Vega: OTTHUMG00000132967
Pharos: Q13257(Tbio)
UniProt: Q13257
Structure
PDB: 

Position
4q27
AA seq 205 aa AA seqDB search
MALQLSREQGITLRGSAEIVAEFFSFGINSILYQRGIYPSETFTRVQKYGLTLLVTTDLE
LIKYLNNVVEQLKDWLYKCSVQKLVVVISNIESGEVLERWQFDIECDKTAKDDSAPREKS
QKAIQDEIRSVIRQITATVTFLPLLEVSCSFDLLIYTDKDLVVPEKWEESGPQFITNSEE
VRLRSFTTTIHKVNSMVAYKIPVND
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atggcgctgcagctctcccgggagcagggaatcaccctgcgcgggagcgccgaaatcgtg
gccgagttcttctcattcggcatcaacagcattttatatcagcgtggcatatatccatct
gaaacctttactcgagtgcagaaatacggactcaccttgcttgtaactactgatcttgag
ctcataaaatacctaaataatgtggtggaacaactgaaagattggttatacaagtgttca
gttcagaaactggttgtagttatctcaaatattgaaagtggtgaggtcctggaaagatgg
cagtttgatattgagtgtgacaagactgcaaaagatgacagtgcacccagagaaaagtct
cagaaagctatccaggatgaaatccgttcagtgatcagacagatcacagctacggtgaca
tttctgccactgttggaagtttcttgttcatttgatctgctgatttatacagacaaagat
ttggttgtacctgaaaaatgggaagagtcgggaccacagtttattaccaattctgaggaa
gtccgccttcgttcatttactactacaatccacaaagtaaatagcatggtggcctacaaa
attcctgtcaatgactga

DBGET integrated database retrieval system