KEGG   Homo sapiens (human): 4086Help
Entry
4086              CDS       T01001                                 

Gene name
SMAD1, BSP-1, BSP1, JV4-1, JV41, MADH1, MADR1
Definition
(RefSeq) SMAD family member 1
  KO
K04676  mothers against decapentaplegic homolog 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04350  TGF-beta signaling pathway
hsa04390  Hippo signaling pathway
hsa04550  Signaling pathways regulating pluripotency of stem cells
hsa05202  Transcriptional misregulation in cancer
Module
hsa_M00679  BMP signaling
Network
N00119  MLL-AF4 fusion to transcriptional activation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04350 TGF-beta signaling pathway
    4086 (SMAD1)
   04390 Hippo signaling pathway
    4086 (SMAD1)
 Cellular Processes
  Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    4086 (SMAD1)
 Human Diseases
  Cancers
   05202 Transcriptional misregulation in cancers
    4086 (SMAD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MH2 MH1 IRF-3 DUF4223
Motif
Other DBs
NCBI-GeneID: 4086
NCBI-ProteinID: NP_001003688
OMIM: 601595
HGNC: 6767
Ensembl: ENSG00000170365
Vega: OTTHUMG00000161592
Pharos: Q15797(Tbio)
UniProt: Q15797
Structure
PDB: 

Position
4q31.21
AA seq 465 aa AA seqDB search
MNVTSLFSFTSPAVKRLLGWKQGDEEEKWAEKAVDALVKKLKKKKGAMEELEKALSCPGQ
PSNCVTIPRSLDGRLQVSHRKGLPHVIYCRVWRWPDLQSHHELKPLECCEFPFGSKQKEV
CINPYHYKRVESPVLPPVLVPRHSEYNPQHSLLAQFRNLGQNEPHMPLNATFPDSFQQPN
SHPFPHSPNSSYPNSPGSSSSTYPHSPTSSDPGSPFQMPADTPPPAYLPPEDPMTQDGSQ
PMDTNMMAPPLPSEINRGDVQAVAYEEPKHWCSIVYYELNNRVGEAFHASSTSVLVDGFT
DPSNNKNRFCLGLLSNVNRNSTIENTRRHIGKGVHLYYVGGEVYAECLSDSSIFVQSRNC
NYHHGFHPTTVCKIPSGCSLKIFNNQEFAQLLAQSVNHGFETVYELTKMCTIRMSFVKGW
GAEYHRQDVTSTPCWIEIHLHGPLQWLDKVLTQMGSPHNPISSVS
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgaatgtgacaagtttattttcctttacaagtccagctgtgaagagacttcttgggtgg
aaacagggcgatgaagaagaaaaatgggcagagaaagctgttgatgctttggtgaaaaaa
ctgaagaaaaagaaaggtgccatggaggaactggaaaaggccttgagctgcccagggcaa
ccgagtaactgtgtcaccattccccgctctctggatggcaggctgcaagtctcccaccgg
aagggactgcctcatgtcatttactgccgtgtgtggcgctggcccgatcttcagagccac
catgaactaaaaccactggaatgctgtgagtttccttttggttccaagcagaaggaggtc
tgcatcaatccctaccactataagagagtagaaagccctgtacttcctcctgtgctggtt
ccaagacacagcgaatataatcctcagcacagcctcttagctcagttccgtaacttagga
caaaatgagcctcacatgccactcaacgccacttttccagattctttccagcaacccaac
agccacccgtttcctcactctcccaatagcagttacccaaactctcctgggagcagcagc
agcacctaccctcactctcccaccagctcagacccaggaagccctttccagatgccagct
gatacgcccccacctgcttacctgcctcctgaagaccccatgacccaggatggctctcag
ccgatggacacaaacatgatggcgcctcccctgccctcagaaatcaacagaggagatgtt
caggcggttgcttatgaggaaccaaaacactggtgctctattgtctactatgagctcaac
aatcgtgtgggtgaagcgttccatgcctcctccacaagtgtgttggtggatggtttcact
gatccttccaacaataagaaccgtttctgccttgggctgctctccaatgttaaccggaat
tccactattgaaaacaccaggcggcatattggaaaaggagttcatctttattatgttgga
ggggaggtgtatgccgaatgccttagtgacagtagcatctttgtgcaaagtcggaactgc
aactaccatcatggatttcatcctactactgtttgcaagatccctagtgggtgtagtctg
aaaatttttaacaaccaagaatttgctcagttattggcacagtctgtgaaccatggattt
gagacagtctatgagcttacaaaaatgtgtactatacgtatgagctttgtgaagggctgg
ggagcagaataccaccgccaggatgttactagcaccccctgctggattgagatacatctg
cacggccccctccagtggctggataaagttcttactcaaatgggttcacctcataatcct
atttcatctgtatcttaa

DBGET integrated database retrieval system