KEGG   Homo sapiens (human): 4086Help
Entry
4086              CDS       T01001                                 

Gene name
SMAD1, BSP-1, BSP1, JV4-1, JV41, MADH1, MADR1
Definition
(RefSeq) SMAD family member 1
  KO
K04676  mothers against decapentaplegic homolog 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04350  TGF-beta signaling pathway
hsa04390  Hippo signaling pathway
hsa04550  Signaling pathways regulating pluripotency of stem cells
hsa05202  Transcriptional misregulation in cancer
Module
hsa_M00679  BMP signaling
Network
N00119  MLL-AF4 fusion to transcriptional activation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    4086 (SMAD1)
   04390 Hippo signaling pathway
    4086 (SMAD1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    4086 (SMAD1)
 09160 Human Diseases
  09161 Cancers: Overview
   05202 Transcriptional misregulation in cancer
    4086 (SMAD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MH2 MH1 IRF-3 DUF4223
Motif
Other DBs
NCBI-GeneID: 4086
NCBI-ProteinID: NP_001003688
OMIM: 601595
HGNC: 6767
Ensembl: ENSG00000170365
Vega: OTTHUMG00000161592
Pharos: Q15797(Tbio)
UniProt: Q15797
Structure
PDB: 

Position
4q31.21
AA seq 465 aa AA seqDB search
MNVTSLFSFTSPAVKRLLGWKQGDEEEKWAEKAVDALVKKLKKKKGAMEELEKALSCPGQ
PSNCVTIPRSLDGRLQVSHRKGLPHVIYCRVWRWPDLQSHHELKPLECCEFPFGSKQKEV
CINPYHYKRVESPVLPPVLVPRHSEYNPQHSLLAQFRNLGQNEPHMPLNATFPDSFQQPN
SHPFPHSPNSSYPNSPGSSSSTYPHSPTSSDPGSPFQMPADTPPPAYLPPEDPMTQDGSQ
PMDTNMMAPPLPSEINRGDVQAVAYEEPKHWCSIVYYELNNRVGEAFHASSTSVLVDGFT
DPSNNKNRFCLGLLSNVNRNSTIENTRRHIGKGVHLYYVGGEVYAECLSDSSIFVQSRNC
NYHHGFHPTTVCKIPSGCSLKIFNNQEFAQLLAQSVNHGFETVYELTKMCTIRMSFVKGW
GAEYHRQDVTSTPCWIEIHLHGPLQWLDKVLTQMGSPHNPISSVS
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgaatgtgacaagtttattttcctttacaagtccagctgtgaagagacttcttgggtgg
aaacagggcgatgaagaagaaaaatgggcagagaaagctgttgatgctttggtgaaaaaa
ctgaagaaaaagaaaggtgccatggaggaactggaaaaggccttgagctgcccagggcaa
ccgagtaactgtgtcaccattccccgctctctggatggcaggctgcaagtctcccaccgg
aagggactgcctcatgtcatttactgccgtgtgtggcgctggcccgatcttcagagccac
catgaactaaaaccactggaatgctgtgagtttccttttggttccaagcagaaggaggtc
tgcatcaatccctaccactataagagagtagaaagccctgtacttcctcctgtgctggtt
ccaagacacagcgaatataatcctcagcacagcctcttagctcagttccgtaacttagga
caaaatgagcctcacatgccactcaacgccacttttccagattctttccagcaacccaac
agccacccgtttcctcactctcccaatagcagttacccaaactctcctgggagcagcagc
agcacctaccctcactctcccaccagctcagacccaggaagccctttccagatgccagct
gatacgcccccacctgcttacctgcctcctgaagaccccatgacccaggatggctctcag
ccgatggacacaaacatgatggcgcctcccctgccctcagaaatcaacagaggagatgtt
caggcggttgcttatgaggaaccaaaacactggtgctctattgtctactatgagctcaac
aatcgtgtgggtgaagcgttccatgcctcctccacaagtgtgttggtggatggtttcact
gatccttccaacaataagaaccgtttctgccttgggctgctctccaatgttaaccggaat
tccactattgaaaacaccaggcggcatattggaaaaggagttcatctttattatgttgga
ggggaggtgtatgccgaatgccttagtgacagtagcatctttgtgcaaagtcggaactgc
aactaccatcatggatttcatcctactactgtttgcaagatccctagtgggtgtagtctg
aaaatttttaacaaccaagaatttgctcagttattggcacagtctgtgaaccatggattt
gagacagtctatgagcttacaaaaatgtgtactatacgtatgagctttgtgaagggctgg
ggagcagaataccaccgccaggatgttactagcaccccctgctggattgagatacatctg
cacggccccctccagtggctggataaagttcttactcaaatgggttcacctcataatcct
atttcatctgtatcttaa

KEGG   Homo sapiens (human): 4090Help
Entry
4090              CDS       T01001                                 

Gene name
SMAD5, DWFC, JV5-1, MADH5
Definition
(RefSeq) SMAD family member 5
  KO
K16790  mothers against decapentaplegic homolog 5
Organism
hsa  Homo sapiens (human)
Pathway
hsa04350  TGF-beta signaling pathway
hsa04550  Signaling pathways regulating pluripotency of stem cells
Module
hsa_M00679  BMP signaling
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    4090 (SMAD5)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    4090 (SMAD5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MH2 MH1 IRF-3
Motif
Other DBs
NCBI-GeneID: 4090
NCBI-ProteinID: NP_001001419
OMIM: 603110
HGNC: 6771
Ensembl: ENSG00000113658
Vega: OTTHUMG00000163212
Pharos: Q99717(Tbio)
UniProt: Q99717 Q68DB7
Position
5q31.1
AA seq 465 aa AA seqDB search
MTSMASLFSFTSPAVKRLLGWKQGDEEEKWAEKAVDALVKKLKKKKGAMEELEKALSSPG
QPSKCVTIPRSLDGRLQVSHRKGLPHVIYCRVWRWPDLQSHHELKPLDICEFPFGSKQKE
VCINPYHYKRVESPVLPPVLVPRHNEFNPQHSLLVQFRNLSHNEPHMPQNATFPDSFHQP
NNTPFPLSPNSPYPPSPASSTYPNSPASSGPGSPFQLPADTPPPAYMPPDDQMGQDNSQP
MDTSNNMIPQIMPSISSRDVQPVAYEEPKHWCSIVYYELNNRVGEAFHASSTSVLVDGFT
DPSNNKSRFCLGLLSNVNRNSTIENTRRHIGKGVHLYYVGGEVYAECLSDSSIFVQSRNC
NFHHGFHPTTVCKIPSSCSLKIFNNQEFAQLLAQSVNHGFEAVYELTKMCTIRMSFVKGW
GAEYHRQDVTSTPCWIEIHLHGPLQWLDKVLTQMGSPLNPISSVS
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgacgtcaatggccagcttgttttcttttactagtccagcagtaaagcgattgttgggc
tggaaacaaggtgatgaggaggagaaatgggcagaaaaggcagttgatgctttggtgaag
aaactaaaaaagaaaaagggtgccatggaggaactggagaaagccttgagcagtccagga
cagccgagtaaatgtgtcactattcccagatctttagatggacgcctgcaggtttctcac
agaaaaggcttaccccatgttatatattgtcgtgtttggcgctggccggatttgcagagt
catcatgagctaaagccgttggatatttgtgaatttccttttggatctaagcaaaaagaa
gtttgtatcaacccataccactataagagagtggagagtccagtcttacctccagtatta
gtgcctcgtcataatgaattcaatccacaacacagccttctggttcagtttaggaacctg
agccacaatgaaccacacatgccacaaaatgccacgtttccagattctttccaccagccc
aacaacactccttttcccttatctccaaacagcccttatcccccttctcctgctagcagc
acatatcccaactccccagcaagttctggaccaggaagtccatttcagctcccagctgat
acgcctcctcctgcctatatgccacctgatgatcagatgggtcaagataattcccagcct
atggatacaagcaataatatgattcctcagattatgcccagtatatccagcagggatgtt
cagcctgttgcctatgaagagcctaaacattggtgttcaatagtctactatgaattaaac
aatcgtgttggagaagcttttcatgcatcttctactagtgtgttagtagatggattcaca
gatccttcaaataacaaaagtagattctgcttgggtttgttgtcaaatgttaatcgtaat
tcgacaattgaaaacactaggcgacatattggaaaaggtgttcatctgtactatgttggt
ggagaggtgtatgcggaatgcctcagtgacagcagcatatttgtacagagtaggaactgc
aactttcatcatggctttcatcccaccactgtctgtaagattcccagcagctgcagcctc
aaaatttttaacaatcaggagtttgctcagcttctggctcaatctgtcaaccatgggttt
gaggcagtatatgagctcaccaaaatgtgtaccattcggatgagttttgtcaagggttgg
ggagcagaatatcaccggcaggatgtaaccagcaccccatgttggattgagattcatctt
catgggcctcttcagtggctggataaagtccttactcagatgggctcccctctgaacccc
atatcttctgtttcataa

KEGG   Homo sapiens (human): 4093Help
Entry
4093              CDS       T01001                                 

Gene name
SMAD9, MADH6, MADH9, PPH2, SMAD8, SMAD8/9, SMAD8A, SMAD8B
Definition
(RefSeq) SMAD family member 9
  KO
K16791  mothers against decapentaplegic homolog 9
Organism
hsa  Homo sapiens (human)
Pathway
hsa04350  TGF-beta signaling pathway
hsa04550  Signaling pathways regulating pluripotency of stem cells
Module
hsa_M00679  BMP signaling
Disease
H01621  Pulmonary arterial hypertension
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    4093 (SMAD9)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    4093 (SMAD9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MH2 MH1 IRF-3 DUF4223
Motif
Other DBs
NCBI-GeneID: 4093
NCBI-ProteinID: NP_001120689
OMIM: 603295
HGNC: 6774
Ensembl: ENSG00000120693
Vega: OTTHUMG00000016740
Pharos: O15198(Tbio)
UniProt: O15198
Position
13q13.3
AA seq 467 aa AA seqDB search
MHSTTPISSLFSFTSPAVKRLLGWKQGDEEEKWAEKAVDSLVKKLKKKKGAMDELERALS
CPGQPSKCVTIPRSLDGRLQVSHRKGLPHVIYCRVWRWPDLQSHHELKPLECCEFPFGSK
QKEVCINPYHYRRVETPVLPPVLVPRHSEYNPQLSLLAKFRSASLHSEPLMPHNATYPDS
FQQPPCSALPPSPSHAFSQSPCTASYPHSPGSPSEPESPYQHSVDTPPLPYHATEASETQ
SGQPVDATADRHVVLSIPNGDFRPVCYEEPQHWCSVAYYELNNRVGETFQASSRSVLIDG
FTDPSNNRNRFCLGLLSNVNRNSTIENTRRHIGKGVHLYYVGGEVYAECVSDSSIFVQSR
NCNYQHGFHPATVCKIPSGCSLKVFNNQLFAQLLAQSVHHGFEVVYELTKMCTIRMSFVK
GWGAEYHRQDVTSTPCWIEIHLHGPLQWLDKVLTQMGSPHNPISSVS
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atgcactccaccacccccatcagctccctcttctccttcaccagccccgcagtgaagaga
ctgctaggctggaagcaaggagatgaagaggaaaagtgggcagagaaggcagtggactct
ctagtgaagaagttaaagaagaagaagggagccatggacgagctggagagggctctcagc
tgcccggggcagcccagcaaatgcgtcacgattccccgctccctggacgggcggctgcag
gtgtcccaccgcaagggcctgccccatgtgatttactgtcgcgtgtggcgctggccggat
ctgcagtcccaccacgagctgaagccgctggagtgctgtgagttcccatttggctccaag
cagaaagaagtgtgcattaacccttaccactaccgccgggtggagactccagtactgcct
cctgtgctcgtgccaagacacagtgaatataacccccagctcagcctcctggccaagttc
cgcagcgcctccctgcacagtgagccactcatgccacacaacgccacctatcctgactct
ttccagcagcctccgtgctctgcactccctccctcacccagccacgcgttctcccagtcc
ccgtgcacggccagctaccctcactccccaggaagtccttctgagccagagagtccctat
caacactcagttgacacaccacccctgccttatcatgccacagaagcctctgagacccag
agtggccaacctgtagatgccacagctgatagacatgtagtgctatcgataccaaatgga
gactttcgaccagtttgttacgaggagccccagcactggtgctcggtcgcctactatgaa
ctgaacaaccgagttggggagacattccaggcttcctcccgaagtgtgctcatagatggg
ttcaccgacccttcaaataacaggaacagattctgtcttggacttctttctaatgtaaac
agaaactcaacgatagaaaataccaggagacatataggaaagggtgtgcacttgtactac
gtcgggggagaggtgtatgccgagtgcgtgagtgacagcagcatctttgtgcagagccgg
aactgcaactatcaacacggcttccacccagctaccgtctgcaagatccccagcggctgc
agcctcaaggtcttcaacaaccagctcttcgctcagctcctggcccagtcagttcaccac
ggctttgaagtcgtgtatgaactgaccaagatgtgtactatccggatgagttttgttaag
ggttggggtgctgagtatcatcgccaggatgtcaccagcaccccctgctggattgagatt
catcttcatgggccactgcagtggctggacaaagttctgactcagatgggctctccacat
aaccccatttcttcagtgtcttaa

DBGET integrated database retrieval system