KEGG   Homo sapiens (human): 4087Help
Entry
4087              CDS       T01001                                 

Gene name
SMAD2, JV18, JV18-1, MADH2, MADR2, hMAD-2, hSMAD2
Definition
(RefSeq) SMAD family member 2
  KO
K04500  mothers against decapentaplegic homolog 2/3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04068  FoxO signaling pathway
hsa04110  Cell cycle
hsa04144  Endocytosis
hsa04218  Cellular senescence
hsa04350  TGF-beta signaling pathway
hsa04371  Apelin signaling pathway
hsa04390  Hippo signaling pathway
hsa04520  Adherens junction
hsa04550  Signaling pathways regulating pluripotency of stem cells
hsa04659  Th17 cell differentiation
hsa04926  Relaxin signaling pathway
hsa04933  AGE-RAGE signaling pathway in diabetic complications
hsa05142  Chagas disease (American trypanosomiasis)
hsa05161  Hepatitis B
hsa05166  Human T-cell leukemia virus 1 infection
hsa05200  Pathways in cancer
hsa05205  Proteoglycans in cancer
hsa05210  Colorectal cancer
hsa05212  Pancreatic cancer
hsa05225  Hepatocellular carcinoma
hsa05226  Gastric cancer
hsa05321  Inflammatory bowel disease (IBD)
Module
hsa_M00680  TGF-beta signaling
hsa_M00681  Activin signaling
Network
N00063  TGF-beta signaling pathway
N00064  Mutation-inactivated TGFBR2 to TGF-beta signaling pathway
N00065  Mutation-inactivated SMAD2 to TGF-beta signaling pathway
N00241  TGFBR2-reduced expression to TGF-beta signaling pathway
N00256  TGFBR1-reduced expression to TGF-beta signaling pathway
N00507  HTLV-1 Tax to TGF-beta signaling pathway
N00531  HBV HBx to TGF-beta signaling pathway
Disease
H00020  Colorectal cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    4087 (SMAD2)
   04390 Hippo signaling pathway
    4087 (SMAD2)
   04371 Apelin signaling pathway
    4087 (SMAD2)
   04068 FoxO signaling pathway
    4087 (SMAD2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    4087 (SMAD2)
  09143 Cell growth and death
   04110 Cell cycle
    4087 (SMAD2)
   04218 Cellular senescence
    4087 (SMAD2)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    4087 (SMAD2)
   04550 Signaling pathways regulating pluripotency of stem cells
    4087 (SMAD2)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    4087 (SMAD2)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    4087 (SMAD2)
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    4087 (SMAD2)
   05205 Proteoglycans in cancer
    4087 (SMAD2)
  09162 Cancers: Specific types
   05210 Colorectal cancer
    4087 (SMAD2)
   05212 Pancreatic cancer
    4087 (SMAD2)
   05225 Hepatocellular carcinoma
    4087 (SMAD2)
   05226 Gastric cancer
    4087 (SMAD2)
  09163 Immune diseases
   05321 Inflammatory bowel disease (IBD)
    4087 (SMAD2)
  09167 Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    4087 (SMAD2)
  09172 Infectious diseases: Viral
   05166 Human T-cell leukemia virus 1 infection
    4087 (SMAD2)
   05161 Hepatitis B
    4087 (SMAD2)
  09174 Infectious diseases: Parasitic
   05142 Chagas disease (American trypanosomiasis)
    4087 (SMAD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MH2 MH1 IRF-3
Motif
Other DBs
NCBI-GeneID: 4087
NCBI-ProteinID: NP_001003652
OMIM: 601366
HGNC: 6768
Ensembl: ENSG00000175387
Vega: OTTHUMG00000132652
Pharos: Q15796(Tbio)
UniProt: Q15796 Q53XR6
Structure
PDB: 

Position
18q21.1
AA seq 467 aa AA seqDB search
MSSILPFTPPVVKRLLGWKKSAGGSGGAGGGEQNGQEEKWCEKAVKSLVKKLKKTGRLDE
LEKAITTQNCNTKCVTIPSTCSEIWGLSTPNTIDQWDTTGLYSFSEQTRSLDGRLQVSHR
KGLPHVIYCRLWRWPDLHSHHELKAIENCEYAFNLKKDEVCVNPYHYQRVETPVLPPVLV
PRHTEILTELPPLDDYTHSIPENTNFPAGIEPQSNYIPETPPPGYISEDGETSDQQLNQS
MDTGSPAELSPTTLSPVNHSLDLQPVTYSEPAFWCSIAYYELNQRVGETFHASQPSLTVD
GFTDPSNSERFCLGLLSNVNRNATVEMTRRHIGRGVRLYYIGGEVFAECLSDSAIFVQSP
NCNQRYGWHPATVCKIPPGCNLKIFNNQEFAALLAQSVNQGFEAVYQLTRMCTIRMSFVK
GWGAEYRRQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSVRCSSMS
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtccatcttgccattcacgccgccagttgtgaagagactgctgggatggaagaag
tcagctggtgggtctggaggagcaggcggaggagagcagaatgggcaggaagaaaagtgg
tgtgagaaagcagtgaaaagtctggtgaagaagctaaagaaaacaggacgattagatgag
cttgagaaagccatcaccactcaaaactgtaatactaaatgtgttaccataccaagcact
tgctctgaaatttggggactgagtacaccaaatacgatagatcagtgggatacaacaggc
ctttacagcttctctgaacaaaccaggtctcttgatggtcgtctccaggtatcccatcga
aaaggattgccacatgttatatattgccgattatggcgctggcctgatcttcacagtcat
catgaactcaaggcaattgaaaactgcgaatatgcttttaatcttaaaaaggatgaagta
tgtgtaaacccttaccactatcagagagttgagacaccagttttgcctccagtattagtg
ccccgacacaccgagatcctaacagaacttccgcctctggatgactatactcactccatt
ccagaaaacactaacttcccagcaggaattgagccacagagtaattatattccagaaacg
ccacctcctggatatatcagtgaagatggagaaacaagtgaccaacagttgaatcaaagt
atggacacaggctctccagcagaactatctcctactactctttcccctgttaatcatagc
ttggatttacagccagttacttactcagaacctgcattttggtgttcgatagcatattat
gaattaaatcagagggttggagaaaccttccatgcatcacagccctcactcactgtagat
ggctttacagacccatcaaattcagagaggttctgcttaggtttactctccaatgttaac
cgaaatgccacggtagaaatgacaagaaggcatataggaagaggagtgcgcttatactac
ataggtggggaagtttttgctgagtgcctaagtgatagtgcaatctttgtgcagagcccc
aattgtaatcagagatatggctggcaccctgcaacagtgtgtaaaattccaccaggctgt
aatctgaagatcttcaacaaccaggaatttgctgctcttctggctcagtctgttaatcag
ggttttgaagccgtctatcagctaactagaatgtgcaccataagaatgagttttgtgaaa
gggtggggagcagaataccgaaggcagacggtaacaagtactccttgctggattgaactt
catctgaatggacctctacagtggttggacaaagtattaactcagatgggatccccttca
gtgcgttgctcaagcatgtcataa

DBGET integrated database retrieval system