KEGG   Homo sapiens (human): 409Help
Entry
409               CDS       T01001                                 

Gene name
ARRB2, ARB2, ARR2, BARR2
Definition
(RefSeq) arrestin beta 2
  KO
K04439  beta-arrestin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04062  Chemokine signaling pathway
hsa04144  Endocytosis
hsa04340  Hedgehog signaling pathway
hsa04728  Dopaminergic synapse
hsa04740  Olfactory transduction
hsa04926  Relaxin signaling pathway
hsa04928  Parathyroid hormone synthesis, secretion and action
hsa05032  Morphine addiction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    409 (ARRB2)
   04340 Hedgehog signaling pathway
    409 (ARRB2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    409 (ARRB2)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    409 (ARRB2)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    409 (ARRB2)
   04928 Parathyroid hormone synthesis, secretion and action
    409 (ARRB2)
  09156 Nervous system
   04728 Dopaminergic synapse
    409 (ARRB2)
  09157 Sensory system
   04740 Olfactory transduction
    409 (ARRB2)
 09160 Human Diseases
  09164 Substance dependence
   05032 Morphine addiction
    409 (ARRB2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    409 (ARRB2)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Clathrin-mediated endocytosis
   GPCR adaptor proteins
    409 (ARRB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Arrestin_N Arrestin_C SCA7
Motif
Other DBs
NCBI-GeneID: 409
NCBI-ProteinID: NP_004304
OMIM: 107941
HGNC: 712
Ensembl: ENSG00000141480
Vega: OTTHUMG00000090759
Pharos: P32121(Tbio)
UniProt: P32121
Position
17p13.2
AA seq 409 aa AA seqDB search
MGEKPGTRVFKKSSPNCKLTVYLGKRDFVDHLDKVDPVDGVVLVDPDYLKDRKVFVTLTC
AFRYGREDLDVLGLSFRKDLFIATYQAFPPVPNPPRPPTRLQDRLLRKLGQHAHPFFFTI
PQNLPCSVTLQPGPEDTGKACGVDFEIRAFCAKSLEEKSHKRNSVRLVIRKVQFAPEKPG
PQPSAETTRHFLMSDRSLHLEASLDKELYYHGEPLNVNVHVTNNSTKTVKKIKVSVRQYA
DICLFSTAQYKCPVAQLEQDDQVSPSSTFCKVYTITPLLSDNREKRGLALDGKLKHEDTN
LASSTIVKEGANKEVLGILVSYRVKVKLVVSRGGDVSVELPFVLMHPKPHDHIPLPRPQS
AAPETDVPVDTNLIEFDTNYATDDDIVFEDFARLRLKGMKDDDYDDQLC
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgggggagaaacccgggaccagggtcttcaagaagtcgagccctaactgcaagctcacc
gtgtacttgggcaagcgggacttcgtagatcacctggacaaagtggaccctgtagatggc
gtggtgcttgtggaccctgactacctgaaggaccgcaaagtgtttgtgaccctcacctgc
gccttccgctatggccgtgaagacctggatgtgctgggcttgtccttccgcaaagacctg
ttcatcgccacctaccaggccttccccccggtgcccaacccaccccggccccccacccgc
ctgcaggaccggctgctgaggaagctgggccagcatgcccaccccttcttcttcaccata
ccccagaatcttccatgctccgtcacactgcagccaggcccagaggatacaggaaaggcc
tgcggcgtagactttgagattcgagccttctgtgctaaatcactagaagagaaaagccac
aaaaggaactctgtgcggctggtgatccgaaaggtgcagttcgccccggagaaacccggc
ccccagccttcagccgaaaccacacgccacttcctcatgtctgaccggtccctgcacctc
gaggcttccctggacaaggagctgtactaccatggggagcccctcaatgtaaatgtccac
gtcaccaacaactccaccaagaccgtcaagaagatcaaagtctctgtgagacagtacgcc
gacatctgcctcttcagcaccgcccagtacaagtgtcctgtggctcaactcgaacaagat
gaccaggtatctcccagctccacattctgtaaggtgtacaccataaccccactgctcagc
gacaaccgggagaagcggggtctcgccctggatgggaaactcaagcacgaggacaccaac
ctggcttccagcaccatcgtgaaggagggtgccaacaaggaggtgctgggaatcctggtg
tcctacagggtcaaggtgaagctggtggtgtctcgaggcggggatgtctctgtggagctg
ccttttgttcttatgcaccccaagccccacgaccacatccccctccccagaccccagtca
gccgctccggagacagatgtccctgtggacaccaacctcattgaatttgataccaactat
gccacagatgatgacattgtgtttgaggactttgcccggcttcggctgaaggggatgaag
gatgacgactatgatgatcaactctgctag

DBGET integrated database retrieval system