KEGG   Homo sapiens (human): 4091Help
Entry
4091              CDS       T01001                                 

Gene name
SMAD6, AOVD2, HsT17432, MADH6, MADH7
Definition
(RefSeq) SMAD family member 6
  KO
K04677  mothers against decapentaplegic homolog 6
Organism
hsa  Homo sapiens (human)
Pathway
hsa04350  TGF-beta signaling pathway
Disease
H00554  Bicuspid aortic valve
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    4091 (SMAD6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MH2 MH1
Motif
Other DBs
NCBI-GeneID: 4091
NCBI-ProteinID: NP_005576
OMIM: 602931
HGNC: 6772
Ensembl: ENSG00000137834
Vega: OTTHUMG00000133218
Pharos: O43541(Tbio)
UniProt: O43541
Position
15q22.31
AA seq 496 aa AA seqDB search
MFRSKRSGLVRRLWRSRVVPDREEGGSGGGGGGDEDGSLGSRAEPAPRAREGGGCGRSEV
RPVAPRRPRDAVGQRGAQGAGRRRRAGGPPRPMSEPGAGAGSSLLDVAEPGGPGWLPESD
CETVTCCLFSERDAAGAPRDASDPLAGAALEPAGGGRSREARSRLLLLEQELKTVTYSLL
KRLKERSLDTLLEAVESRGGVPGGCVLVPRADLRLGGQPAPPQLLLGRLFRWPDLQHAVE
LKPLCGCHSFAAAADGPTVCCNPYHFSRLCGPESPPPPYSRLSPRDEYKPLDLSDSTLSY
TETEATNSLITAPGEFSDASMSPDATKPSHWCSVAYWEHRTRVGRLYAVYDQAVSIFYDL
PQGSGFCLGQLNLEQRSESVRRTRSKIGFGILLSKEPDGVWAYNRGEHPIFVNSPTLDAP
GGRALVVRKVPPGYSIKVFDFERSGLQHAPEPDAADGPYDPNSVRISFAKGWGPCYSRQF
ITSCPCWLEILLNNPR
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgttcaggtccaaacgctcggggctggtgcggcgactttggcgaagtcgtgtggtcccc
gaccgggaggaaggcggcagcggcggcggcggtggcggcgacgaggatgggagcttgggc
agccgagctgagccggccccgcgggcaagagagggcggaggctgcggccgctccgaagtc
cgcccggtagccccgcggcggccccgggacgcagtgggacagcgaggcgcccagggcgcg
gggaggcgccggcgcgcagggggccccccgaggcccatgtcggagccaggggccggcgct
gggagctccctgctggacgtggcggagccgggaggcccgggctggctgcccgagagtgac
tgcgagacggtgacctgctgtctcttttcggagcgggacgccgccggcgcgccccgggac
gccagcgaccccctggccggggcggccctggagccggcgggcggcgggcggagtcgcgaa
gcgcgctcgcggctgctgctgctggagcaggaactcaaaaccgtcacgtactcgctgctg
aagcggctcaaggagcgctcgctggacacgctgctggaggcggtggagtcccgcggcggc
gtgccgggcggctgcgtgctggtgccgcgcgccgacctccgcctgggcggccagcccgcg
ccgccgcagctgctgctcggccgcctctttcgctggcccgacctgcagcacgccgtggag
ctgaagcccctgtgcggctgccacagcttcgccgccgccgccgacggccctaccgtgtgc
tgcaacccctaccacttcagccggctctgcgggcccgaatctccgccacctccctactct
cggctgtctcctcgcgacgagtacaagccactggatctgtccgattccacattgtcttac
actgaaacggaggctaccaactccctcatcactgctccgggtgaattctcagacgccagc
atgtctccggacgccaccaagccgagccactggtgcagcgtggcgtactgggagcaccgg
acgcgcgtgggccgcctctatgcggtgtacgaccaggccgtcagcatcttctacgaccta
cctcagggcagcggcttctgcctgggccagctcaacctggagcagcgcagcgagtcggtg
cggcgaacgcgcagcaagatcggcttcggcatcctgctcagcaaggagcccgacggcgtg
tgggcctacaaccgcggcgagcaccccatcttcgtcaactccccgacgctggacgcgccc
ggcggccgcgccctggtcgtgcgcaaggtgccccccggctactccatcaaggtgttcgac
ttcgagcgctcgggcctgcagcacgcgcccgagcccgacgccgccgacggcccctacgac
cccaacagcgtccgcatcagcttcgccaagggctgggggccctgctactcccggcagttc
atcacctcctgcccctgctggctggagatcctcctcaacaaccccagatag

KEGG   Homo sapiens (human): 4092Help
Entry
4092              CDS       T01001                                 

Gene name
SMAD7, CRCS3, MADH7, MADH8
Definition
(RefSeq) SMAD family member 7
  KO
K19631  mothers against decapentaplegic homolog 7
Organism
hsa  Homo sapiens (human)
Pathway
hsa04350  TGF-beta signaling pathway
hsa04390  Hippo signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    4092 (SMAD7)
   04390 Hippo signaling pathway
    4092 (SMAD7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MH2 MH1
Motif
Other DBs
NCBI-GeneID: 4092
NCBI-ProteinID: NP_005895
OMIM: 602932
HGNC: 6773
Ensembl: ENSG00000101665
Vega: OTTHUMG00000132655
Pharos: O15105(Tbio)
UniProt: O15105
Position
18q21.1
AA seq 426 aa AA seqDB search
MFRTKRSALVRRLWRSRAPGGEDEEEGAGGGGGGGELRGEGATDSRAHGAGGGGPGRAGC
CLGKAVRGAKGHHHPHPPAAGAGAAGGAEADLKALTHSVLKKLKERQLELLLQAVESRGG
TRTACLLLPGRLDCRLGPGAPAGAQPAQPPSSYSLPLLLCKVFRWPDLRHSSEVKRLCCC
ESYGKINPELVCCNPHHLSRLCELESPPPPYSRYPMDFLKPTADCPDAVPSSAETGGTNY
LAPGGLSDSQLLLEPGDRSHWCVVAYWEEKTRVGRLYCVQEPSLDIFYDLPQGNGFCLGQ
LNSDNKSQLVQKVRSKIGCGIQLTREVDGVWVYNRSSYPIFIKSATLDNPDSRTLLVHKV
FPGFSIKAFDYEKAYSLQRPNDHEFMQQPWTGFTVQISFVKGWGQCYTRQFISSCPCWLE
VIFNSR
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgttcaggaccaaacgatctgcgctcgtccggcgtctctggaggagccgtgcgcccggc
ggcgaggacgaggaggagggcgcagggggaggtggaggaggaggcgagctgcggggagaa
ggggcgacggacagccgagcgcatggggccggtggcggcggcccgggcagggctggatgc
tgcctgggcaaggcggtgcgaggtgccaaaggtcaccaccatccccacccgccagccgcg
ggcgccggcgcggccgggggcgccgaggcggatctgaaggcgctcacgcactcggtgctc
aagaaactgaaggagcggcagctggagctgctgctccaggccgtggagtcccgcggcggg
acgcgcaccgcgtgcctcctgctgcccggccgcctggactgcaggctgggcccgggggcg
cccgccggcgcgcagcctgcgcagccgccctcgtcctactcgctccccctcctgctgtgc
aaagtgttcaggtggccggatctcaggcattcctcggaagtcaagaggctgtgttgctgt
gaatcttacgggaagatcaaccccgagctggtgtgctgcaacccccatcaccttagccga
ctctgcgaactagagtctcccccccctccttactccagatacccgatggattttctcaaa
ccaactgcagactgtccagatgctgtgccttcctccgctgaaacagggggaacgaattat
ctggcccctggggggctttcagattcccaacttcttctggagcctggggatcggtcacac
tggtgcgtggtggcatactgggaggagaagacgagagtggggaggctctactgtgtccag
gagccctctctggatatcttctatgatctacctcaggggaatggcttttgcctcggacag
ctcaattcggacaacaagagtcagctggtgcagaaggtgcggagcaaaatcggctgcggc
atccagctgacgcgggaggtggatggtgtgtgggtgtacaaccgcagcagttaccccatc
ttcatcaagtccgccacactggacaacccggactccaggacgctgttggtacacaaggtg
ttccccggtttctccatcaaggctttcgactacgagaaggcgtacagcctgcagcggccc
aatgaccacgagtttatgcagcagccgtggacgggctttaccgtgcagatcagctttgtg
aagggctggggccagtgctacacccgccagttcatcagcagctgcccgtgctggctagag
gtcatcttcaacagccggtag

DBGET integrated database retrieval system