KEGG   Homo sapiens (human): 4092
Entry
4092              CDS       T01001                                 
Symbol
SMAD7, CRCS3, MADH7, MADH8
Name
(RefSeq) SMAD family member 7
  KO
K19631  mothers against decapentaplegic homolog 7
Organism
hsa  Homo sapiens (human)
Pathway
hsa04350  TGF-beta signaling pathway
hsa04390  Hippo signaling pathway
Disease
H00020  Colorectal cancer
Drug target
Mongersen (DG02694): D10955 D10956
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    4092 (SMAD7)
   04390 Hippo signaling pathway
    4092 (SMAD7)
SSDB
Motif
Pfam: MH2 MH1
Other DBs
NCBI-GeneID: 4092
NCBI-ProteinID: NP_005895
OMIM: 602932
HGNC: 6773
Ensembl: ENSG00000101665
Pharos: O15105(Tbio)
UniProt: O15105
Structure
Position
18:complement(48919853..48950965)
AA seq 426 aa
MFRTKRSALVRRLWRSRAPGGEDEEEGAGGGGGGGELRGEGATDSRAHGAGGGGPGRAGC
CLGKAVRGAKGHHHPHPPAAGAGAAGGAEADLKALTHSVLKKLKERQLELLLQAVESRGG
TRTACLLLPGRLDCRLGPGAPAGAQPAQPPSSYSLPLLLCKVFRWPDLRHSSEVKRLCCC
ESYGKINPELVCCNPHHLSRLCELESPPPPYSRYPMDFLKPTADCPDAVPSSAETGGTNY
LAPGGLSDSQLLLEPGDRSHWCVVAYWEEKTRVGRLYCVQEPSLDIFYDLPQGNGFCLGQ
LNSDNKSQLVQKVRSKIGCGIQLTREVDGVWVYNRSSYPIFIKSATLDNPDSRTLLVHKV
FPGFSIKAFDYEKAYSLQRPNDHEFMQQPWTGFTVQISFVKGWGQCYTRQFISSCPCWLE
VIFNSR
NT seq 1281 nt   +upstreamnt  +downstreamnt
atgttcaggaccaaacgatctgcgctcgtccggcgtctctggaggagccgtgcgcccggc
ggcgaggacgaggaggagggcgcagggggaggtggaggaggaggcgagctgcggggagaa
ggggcgacggacagccgagcgcatggggccggtggcggcggcccgggcagggctggatgc
tgcctgggcaaggcggtgcgaggtgccaaaggtcaccaccatccccacccgccagccgcg
ggcgccggcgcggccgggggcgccgaggcggatctgaaggcgctcacgcactcggtgctc
aagaaactgaaggagcggcagctggagctgctgctccaggccgtggagtcccgcggcggg
acgcgcaccgcgtgcctcctgctgcccggccgcctggactgcaggctgggcccgggggcg
cccgccggcgcgcagcctgcgcagccgccctcgtcctactcgctccccctcctgctgtgc
aaagtgttcaggtggccggatctcaggcattcctcggaagtcaagaggctgtgttgctgt
gaatcttacgggaagatcaaccccgagctggtgtgctgcaacccccatcaccttagccga
ctctgcgaactagagtctcccccccctccttactccagatacccgatggattttctcaaa
ccaactgcagactgtccagatgctgtgccttcctccgctgaaacagggggaacgaattat
ctggcccctggggggctttcagattcccaacttcttctggagcctggggatcggtcacac
tggtgcgtggtggcatactgggaggagaagacgagagtggggaggctctactgtgtccag
gagccctctctggatatcttctatgatctacctcaggggaatggcttttgcctcggacag
ctcaattcggacaacaagagtcagctggtgcagaaggtgcggagcaaaatcggctgcggc
atccagctgacgcgggaggtggatggtgtgtgggtgtacaaccgcagcagttaccccatc
ttcatcaagtccgccacactggacaacccggactccaggacgctgttggtacacaaggtg
ttccccggtttctccatcaaggctttcgactacgagaaggcgtacagcctgcagcggccc
aatgaccacgagtttatgcagcagccgtggacgggctttaccgtgcagatcagctttgtg
aagggctggggccagtgctacacccgccagttcatcagcagctgcccgtgctggctagag
gtcatcttcaacagccggtag

DBGET integrated database retrieval system