KEGG   Homo sapiens (human): 4094Help
Entry
4094              CDS       T01001                                 

Gene name
MAF, AYGRP, CCA4, CTRCT21, c-MAF
Definition
(RefSeq) MAF bZIP transcription factor
  KO
K09035  transcription factor Maf
Organism
hsa  Homo sapiens (human)
Pathway
hsa04658  Th1 and Th2 cell differentiation
hsa05202  Transcriptional misregulation in cancer
hsa05321  Inflammatory bowel disease (IBD)
Network
N00124  IGH-MAF fusion to transcriptional activation
Disease
H00010  Multiple myeloma
H01202  Cataract
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    4094 (MAF)
 09160 Human Diseases
  09161 Cancers: Overview
   05202 Transcriptional misregulation in cancer
    4094 (MAF)
  09163 Immune diseases
   05321 Inflammatory bowel disease (IBD)
    4094 (MAF)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    4094 (MAF)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, Maf
    4094 (MAF)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: bZIP_Maf Maf_N ZapB bZIP_1 TraT bZIP_2 HOOK KASH_CCD JIP_LZII APC_N_CC vATP-synt_E
Motif
Other DBs
NCBI-GeneID: 4094
NCBI-ProteinID: NP_001026974
OMIM: 177075
HGNC: 6776
Ensembl: ENSG00000178573
Vega: OTTHUMG00000137621
Pharos: O75444(Tbio)
UniProt: O75444
Position
16q23.2
AA seq 373 aa AA seqDB search
MASELAMSNSDLPTSPLAMEYVNDFDLMKFEVKKEPVETDRIISQCGRLIAGGSLSSTPM
STPCSSVPPSPSFSAPSPGSGSEQKAHLEDYYWMTGYPQQLNPEALGFSPEDAVEALISN
SHQLQGGFDGYARGAQQLAAAAGAGAGASLGGSGEEMGPAAAVVSAVIAAAAAQSGAGPH
YHHHHHHAAGHHHHPTAGAPGAAGSAAASAGGAGGAGGGGPASAGGGGGGGGGGGGGGAA
GAGGALHPHHAAGGLHFDDRFSDEQLVTMSVRELNRQLRGVSKEEVIRLKQKRRTLKNRG
YAQSCRFKRVQQRHVLESEKNQLLQQVDHLKQEISRLVRERDAYKEKYEKLVSSGFRENG
SSSDNPSSPEFFM
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atggcatcagaactggcaatgagcaactccgacctgcccaccagtcccctggccatggaa
tatgttaatgacttcgatctgatgaagtttgaagtgaaaaaggaaccggtggagaccgac
cgcatcatcagccagtgcggccgtctcatcgccgggggctcgctgtcctccacccccatg
agcacgccgtgcagctcggtgcccccttcccccagcttctcggcgcccagcccgggctcg
ggcagcgagcagaaggcgcacctggaagactactactggatgaccggctacccgcagcag
ctgaaccccgaggcgctgggcttcagccccgaggacgcggtcgaggcgctcatcagcaac
agccaccagctccagggcggcttcgatggctacgcgcgcggggcgcagcagctggccgcg
gcggccggggccggtgccggcgcctccttgggcggcagcggcgaggagatgggccccgcc
gccgccgtggtgtccgccgtgatcgccgcggccgccgcgcagagcggcgcgggcccgcac
taccaccaccaccaccaccacgccgccggccaccaccaccacccgacggccggcgcgccc
ggcgccgcgggcagcgcggccgcctcggccggtggcgctgggggcgcgggcggcggtggc
ccggccagcgctgggggcggcggcggcggcggcggcggcggaggcggcgggggcgcggcg
ggggcggggggcgccctgcacccgcaccacgccgccggcggcctgcacttcgacgaccgc
ttctccgacgagcagctggtgaccatgtctgtgcgcgagctgaaccggcagctgcgcggg
gtcagcaaggaggaggtgatccggctgaagcagaagaggcggaccctgaaaaaccgcggc
tatgcccagtcctgccgcttcaagagggtgcagcagagacacgtcctggagtcggagaag
aaccagctgctgcagcaagtcgaccacctcaagcaggagatctccaggctggtgcgcgag
agggacgcgtacaaggagaaatacgagaagttggtgagcagcggcttccgagaaaacggc
tcgagcagcgacaacccgtcctctcccgagtttttcatgtga

DBGET integrated database retrieval system