KEGG   Homo sapiens (human): 4099Help
Entry
4099              CDS       T01001                                 

Gene name
MAG, GMA, S-MAG, SIGLEC-4A, SIGLEC4A, SPG75
Definition
(RefSeq) myelin associated glycoprotein
  KO
K06771  myelin associated glycoprotein
Organism
hsa  Homo sapiens (human)
Pathway
hsa04514  Cell adhesion molecules (CAMs)
Disease
H00266  Hereditary spastic paraplegia (SPG)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    4099 (MAG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:hsa04515]
    4099 (MAG)
   04091 Lectins [BR:hsa04091]
    4099 (MAG)
Cell adhesion molecules [BR:hsa04515]
 Immunoglobulin superfamily
  MAG
   4099 (MAG)
Lectins [BR:hsa04091]
 I-type lectins (Siglecs)
  4099 (MAG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ig_3 Ig_2 I-set V-set C2-set_2 ig Ig_5 Izumo-Ig
Motif
Other DBs
NCBI-GeneID: 4099
NCBI-ProteinID: NP_002352
OMIM: 159460
HGNC: 6783
Ensembl: ENSG00000105695
Vega: OTTHUMG00000183296
Pharos: P20916(Tchem)
UniProt: P20916 Q53ES7
Position
19q13.12
AA seq 626 aa AA seqDB search
MIFLTALPLFWIMISASRGGHWGAWMPSSISAFEGTCVSIPCRFDFPDELRPAVVHGVWY
FNSPYPKNYPPVVFKSRTQVVHESFQGRSRLLGDLGLRNCTLLLSNVSPELGGKYYFRGD
LGGYNQYTFSEHSVLDIVNTPNIVVPPEVVAGTEVEVSCMVPDNCPELRPELSWLGHEGL
GEPAVLGRLREDEGTWVQVSLLHFVPTREANGHRLGCQASFPNTTLQFEGYASMDVKYPP
VIVEMNSSVEAIEGSHVSLLCGADSNPPPLLTWMRDGTVLREAVAESLLLELEEVTPAED
GVYACLAENAYGQDNRTVGLSVMYAPWKPTVNGTMVAVEGETVSILCSTQSNPDPILTIF
KEKQILSTVIYESELQLELPAVSPEDDGEYWCVAENQYGQRATAFNLSVEFAPVLLLESH
CAAARDTVQCLCVVKSNPEPSVAFELPSRNVTVNESEREFVYSERSGLVLTSILTLRGQA
QAPPRVICTARNLYGAKSLELPFQGAHRLMWAKIGPVGAVVAFAILIAIVCYITQTRRKK
NVTESPSFSAGDNPPVLFSSDFRISGAPEKYESERRLGSERRLLGLRGEPPELDLSYSHS
DLGKRPTKDSYTLTEELAEYAEIRVK
NT seq 1881 nt NT seq  +upstreamnt  +downstreamnt
atgatattcctcacggcactgcctctgttctggattatgatttcagcctcccgagggggt
cactggggtgcctggatgccctcgtccatctcggccttcgaaggcacgtgcgtctccatc
ccctgccgctttgacttcccggatgagctgcggcccgctgtggtgcatggtgtctggtac
ttcaatagcccctaccccaagaactaccccccggtggtcttcaagtcgcgcacccaagta
gtccacgagagcttccagggccgcagccgcctcctgggggacctgggcctgcgaaactgc
accctcctgctcagcaacgtcagccccgagctgggcgggaagtactacttccgtggggac
ctgggcggctacaaccagtacaccttctcagagcacagcgtcctggatatcgtcaacacc
cccaacatcgtggtgcccccagaggtggtggcaggcacggaggtggaggtcagctgcatg
gtgccggacaactgcccagagctgcgccctgagctgagctggctgggccacgaggggctg
ggggagcccgctgtgctgggccggctgcgggaggacgagggcacctgggtgcaggtgtca
ctgctgcacttcgtgcccacgagggaggccaacggccacaggctgggctgccaggcctcc
ttccccaacaccaccctgcagttcgagggctacgccagcatggacgtcaagtaccccccg
gtgattgtggagatgaactcctcggtggaggccatcgagggctcccacgtgagcctgctc
tgtggggctgacagcaaccccccgccgctgctgacctggatgcgggacgggacagtcctc
cgggaggcggtggccgagagcctgctcctggagctggaggaggtgacccccgccgaagac
ggcgtctatgcctgcctggccgagaatgcctatggccaggacaaccgcaccgtggggctc
agtgtcatgtatgcaccctggaagccaacagtgaacgggacaatggtggccgtagagggg
gagacggtctctatcttgtgctccacacagagcaacccggaccctattctcaccatcttc
aaggagaagcagatcctgtccacggtcatctacgagagcgagctgcagctggagctgccg
gccgtgtcacccgaggatgatggagagtactggtgtgtggctgagaaccagtatggccag
agggccaccgccttcaacctgtctgtggagttcgcccctgtgctcctcctggagtcccac
tgcgcggcagcccgagacacggtgcagtgcctgtgcgtggtgaagtccaacccggagccg
tccgtggcctttgagctgccatcgcgcaatgtgaccgtgaacgagagcgagcgggagttc
gtgtactcggagcgcagcggcctcgtgctcaccagcatcctcacgctgcgggggcaggcc
caggccccgccccgcgtcatctgcaccgcgaggaacctctatggcgccaagagcctggag
ctgcccttccagggagcccatcgactgatgtgggccaagatcgggcctgtgggcgccgtg
gtcgcctttgccatcctgattgccatcgtctgctacattacccagacacgcaggaaaaag
aacgtgacagagagccccagcttctcggcaggggacaaccctcccgtcctgttcagcagc
gacttccgcatctctggggcaccagagaagtacgagagcgagaggcgcctgggatctgag
aggaggctgctgggccttcggggtgagcccccagagctggacctgagctattctcactcg
gacctggggaaacggcccaccaaggacagctacacgctgacggaggagctagctgagtat
gctgaaatccgggtcaagtga

DBGET integrated database retrieval system