KEGG   Homo sapiens (human): 4100Help
Entry
4100              CDS       T01001                                 

Gene name
MAGEA1, CT1.1, MAGE1
Definition
(RefSeq) MAGE family member A1
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: MAGE MAGE_N
Motif
Other DBs
NCBI-GeneID: 4100
NCBI-ProteinID: NP_004979
OMIM: 300016
HGNC: 6796
Ensembl: ENSG00000198681
Vega: OTTHUMG00000024192
Pharos: P43355(Tbio)
UniProt: P43355
Position
Xq28
AA seq 309 aa AA seqDB search
MSLEQRSLHCKPEEALEAQQEALGLVCVQAATSSSSPLVLGTLEEVPTAGSTDPPQSPQG
ASAFPTTINFTRQRQPSEGSSSREEEGPSTSCILESLFRAVITKKVADLVGFLLLKYRAR
EPVTKAEMLESVIKNYKHCFPEIFGKASESLQLVFGIDVKEADPTGHSYVLVTCLGLSYD
GLLGDNQIMPKTGFLIIVLVMIAMEGGHAPEEEIWEELSVMEVYDGREHSAYGEPRKLLT
QDLVQEKYLEYRQVPDSDPARYEFLWGPRALAETSYVKVLEYVIKVSARVRFFFPSLREA
ALREEEEGV
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgtctcttgagcagaggagtctgcactgcaagcctgaggaagcccttgaggcccaacaa
gaggccctgggcctggtgtgtgtgcaggctgccacctcctcctcctctcctctggtcctg
ggcaccctggaggaggtgcccactgctgggtcaacagatcctccccagagtcctcaggga
gcctccgcctttcccactaccatcaacttcactcgacagaggcaacccagtgagggttcc
agcagccgtgaagaggaggggccaagcacctcttgtatcctggagtccttgttccgagca
gtaatcactaagaaggtggctgatttggttggttttctgctcctcaaatatcgagccagg
gagccagtcacaaaggcagaaatgctggagagtgtcatcaaaaattacaagcactgtttt
cctgagatcttcggcaaagcctctgagtccttgcagctggtctttggcattgacgtgaag
gaagcagaccccaccggccactcctatgtccttgtcacctgcctaggtctctcctatgat
ggcctgctgggtgataatcagatcatgcccaagacaggcttcctgataattgtcctggtc
atgattgcaatggagggcggccatgctcctgaggaggaaatctgggaggagctgagtgtg
atggaggtgtatgatgggagggagcacagtgcctatggggagcccaggaagctgctcacc
caagatttggtgcaggaaaagtacctggagtaccggcaggtgccggacagtgatcccgca
cgctatgagttcctgtggggtccaagggccctcgctgaaaccagctatgtgaaagtcctt
gagtatgtgatcaaggtcagtgcaagagttcgctttttcttcccatccctgcgtgaagca
gctttgagagaggaggaagagggagtctga

DBGET integrated database retrieval system