KEGG   Homo sapiens (human): 4105Help
Entry
4105              CDS       T01001                                 

Gene name
MAGEA6, CT1.6, MAGE-3b, MAGE3B, MAGE6
Definition
(RefSeq) MAGE family member A6
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: MAGE_N MAGE
Motif
Other DBs
NCBI-GeneID: 4105
NCBI-ProteinID: NP_005354
OMIM: 300176
HGNC: 6804
Ensembl: ENSG00000197172
Vega: OTTHUMG00000022642
Pharos: P43360(Tbio)
UniProt: P43360
Position
Xq28
AA seq 314 aa AA seqDB search
MPLEQRSQHCKPEEGLEARGEALGLVGAQAPATEEQEAASSSSTLVEVTLGEVPAAESPD
PPQSPQGASSLPTTMNYPLWSQSYEDSSNQEEEGPSTFPDLESEFQAALSRKVAKLVHFL
LLKYRAREPVTKAEMLGSVVGNWQYFFPVIFSKASDSLQLVFGIELMEVDPIGHVYIFAT
CLGLSYDGLLGDNQIMPKTGFLIIILAIIAKEGDCAPEEKIWEELSVLEVFEGREDSIFG
DPKKLLTQYFVQENYLEYRQVPGSDPACYEFLWGPRALIETSYVKVLHHMVKISGGPRIS
YPLLHEWALREGEE
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgcctcttgagcagaggagtcagcactgcaagcctgaagaaggccttgaggcccgagga
gaggccctgggcctggtgggtgcgcaggctcctgctactgaggagcaggaggctgcctcc
tcctcttctactctagttgaagtcaccctgggggaggtgcctgctgccgagtcaccagat
cctccccagagtcctcagggagcctccagcctccccactaccatgaactaccctctctgg
agccaatcctatgaggactccagcaaccaagaagaggaggggccaagcaccttccctgac
ctggagtctgagttccaagcagcactcagtaggaaggtggccaagttggttcattttctg
ctcctcaagtatcgagccagggagccggtcacaaaggcagaaatgctggggagtgtcgtc
ggaaattggcagtacttctttcctgtgatcttcagcaaagcttccgattccttgcagctg
gtctttggcatcgagctgatggaagtggaccccatcggccacgtgtacatctttgccacc
tgcctgggcctctcctacgatggcctgctgggtgacaatcagatcatgcccaagacaggc
ttcctgataatcatcctggccataatcgcaaaagagggcgactgtgcccctgaggagaaa
atctgggaggagctgagtgtgttagaggtgtttgaggggagggaagacagtatcttcggg
gatcccaagaagctgctcacccaatatttcgtgcaggaaaactacctggagtaccggcag
gtccccggcagtgatcctgcatgctatgagttcctgtggggtccaagggccctcattgaa
accagctatgtgaaagtcctgcaccatatggtaaagatcagtggaggacctcgcatttcc
tacccactcctgcatgagtgggctttgagagagggggaagagtga

DBGET integrated database retrieval system