KEGG   Homo sapiens (human): 411Help
Entry
411               CDS       T01001                                 

Gene name
ARSB, ASB, G4S, MPS6
Definition
(RefSeq) arylsulfatase B
  KO
K01135  arylsulfatase B [EC:3.1.6.12]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00531  Glycosaminoglycan degradation
hsa01100  Metabolic pathways
hsa04142  Lysosome
Module
hsa_M00076  Dermatan sulfate degradation
hsa_M00077  Chondroitin sulfate degradation
Disease
H00131  Mucopolysaccharidosis type VI
H00421  Mucopolysaccharidosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    411 (ARSB)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    411 (ARSB)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.6  Sulfuric-ester hydrolases
    3.1.6.12  N-acetylgalactosamine-4-sulfatase
     411 (ARSB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sulfatase Phosphodiest Sulfatase_C
Motif
Other DBs
NCBI-GeneID: 411
NCBI-ProteinID: NP_000037
OMIM: 611542
HGNC: 714
Ensembl: ENSG00000113273
Vega: OTTHUMG00000108129
Pharos: P15848(Tbio)
UniProt: P15848 A0A024RAJ9
Structure
PDB: 

Position
5q14.1
AA seq 533 aa AA seqDB search
MGPRGAASLPRGPGPRRLLLPVVLPLLLLLLLAPPGSGAGASRPPHLVFLLADDLGWNDV
GFHGSRIRTPHLDALAAGGVLLDNYYTQPLCTPSRSQLLTGRYQIRTGLQHQIIWPCQPS
CVPLDEKLLPQLLKEAGYTTHMVGKWHLGMYRKECLPTRRGFDTYFGYLLGSEDYYSHER
CTLIDALNVTRCALDFRDGEEVATGYKNMYSTNIFTKRAIALITNHPPEKPLFLYLALQS
VHEPLQVPEEYLKPYDFIQDKNRHHYAGMVSLMDEAVGNVTAALKSSGLWNNTVFIFSTD
NGGQTLAGGNNWPLRGRKWSLWEGGVRGVGFVASPLLKQKGVKNRELIHISDWLPTLVKL
ARGHTNGTKPLDGFDVWKTISEGSPSPRIELLHNIDPNFVDSSPCPRNSMAPAKDDSSLP
EYSAFNTSVHAAIRHGNWKLLTGYPGCGYWFPPPSQYNVSEIPSSDPPTKTLWLFDIDRD
PEERHDLSREYPHIVTKLLSRLQFYHKHSVPVYFPAQDPRCDPKATGVWGPWM
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atgggtccgcgcggcgcggcgagcttgccccgaggccccggacctcggcggctgctcctc
cccgtcgtcctcccgctgctgctgctgctgttgttggcgccgccgggctcgggcgccggg
gccagccggccgccccacctggtcttcttgctggcagacgacctaggctggaacgacgtc
ggcttccacggctcccgcatccgcacgccgcacctggacgcgctggcggccggcggggtg
ctcctggacaactactacacgcagccgctgtgcacgccgtcgcggagccagctgctcact
ggccgctaccagatccgtacaggtttacagcaccaaataatctggccctgtcagcccagc
tgtgttcctctggatgaaaaactcctgccccagctcctaaaagaagcaggttatactacc
catatggtcggaaaatggcacctgggaatgtaccggaaagaatgccttccaacccgccga
ggatttgatacctactttggatatctcctgggtagtgaagattattattcccatgaacgc
tgtacattaattgacgctctgaatgtcacacgatgtgctcttgattttcgagatggcgaa
gaagttgcaacaggatataaaaatatgtattcaacaaacatattcaccaaaagggctata
gccctcataactaaccatccaccagagaagcctctgtttctctaccttgctctccagtct
gtgcatgagccccttcaggtccctgaggaatacttgaagccatatgactttatccaagac
aagaacaggcatcactatgcaggaatggtgtcccttatggatgaagcagtaggaaatgtc
actgcagctttaaaaagcagtgggctctggaacaacacggtgttcatcttttctacagat
aacggagggcagactttggcagggggtaataactggccccttcgaggaagaaaatggagc
ctgtgggaaggaggcgtccgaggggtgggctttgtggcaagccccttgctgaagcagaag
ggcgtgaagaaccgggagctcatccacatctctgactggctgccaacactcgtgaagctg
gccaggggacacaccaatggcacaaagcctctggatggcttcgacgtgtggaaaaccatc
agtgaaggaagcccatcccccagaattgagctgctgcataatattgacccgaacttcgtg
gactcttcaccgtgtcccaggaacagcatggctccagcaaaggatgactcttctcttcca
gaatattcagcctttaacacatctgtccatgctgcaattagacatggaaattggaaactc
ctcacgggctacccaggctgtggttactggttccctccaccgtctcaatacaatgtttct
gagataccctcatcagacccaccaaccaagaccctctggctctttgatattgatcgggac
cctgaagaaagacatgacctgtccagagaatatcctcacatcgtcacaaagctcctgtcc
cgcctacagttctaccataaacactcagtccccgtgtacttccctgcacaggacccccgc
tgtgatcccaaggccactggggtgtggggcccttggatgtag

DBGET integrated database retrieval system