KEGG   Homo sapiens (human): 4115Help
Entry
4115              CDS       T01001                                 

Gene name
MAGEB4, CT3.6
Definition
(RefSeq) MAGE family member B4
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: MAGE_N MAGE DUF3452
Motif
Other DBs
NCBI-GeneID: 4115
NCBI-ProteinID: NP_002358
OMIM: 300153
HGNC: 6811
Ensembl: ENSG00000120289
Vega: OTTHUMG00000021321
Pharos: O15481(Tdark)
UniProt: O15481
Position
Xp21.2
AA seq 346 aa AA seqDB search
MPRGQKSKLRAREKRQRTRGQTQDLKVGQPTAAEKEESPSSSSSVLRDTASSSLAFGIPQ
EPQREPPTTSAAAAMSCTGSDKGDESQDEENASSSQASTSTERSLKDSLTRKTKMLVQFL
LYKYKMKEPTTKAEMLKIISKKYKEHFPEIFRKVSQRTELVFGLALKEVNPTTHSYILVS
MLGPNDGNQSSAWTLPRNGLLMPLLSVIFLNGNCAREEEIWEFLNMLGIYDGKRHLIFGE
PRKLITQDLVQEKYLEYQQVPNSDPPRYQFLWGPRAHAETSKMKVLEFLAKVNDTTPNNF
PLLYEEALRDEEERAGARPRVAARRGTTAMTSAYSRATSSSSSQPM
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgcctcggggtcagaagagtaagctccgtgcccgtgagaaacgccagcggacccgtggt
cagacccaggatctcaaggttggtcagcctactgcagcagagaaagaagagtctccttcc
tcttcctcatctgttttgagggatactgcctccagctcccttgcttttggcattccccag
gagcctcagagagagccacccaccacctctgctgctgcagctatgtcatgcactggatct
gataaaggcgacgagagccaagatgaggaaaatgcaagttcctcccaggcctcaacatcc
actgagagatcactcaaagattctctaaccaggaagacgaagatgttagtgcagttcctg
ctgtacaagtataaaatgaaagagcccactacaaaggcagaaatgctgaagatcatcagc
aaaaagtacaaggagcacttccctgagatcttcaggaaagtctctcagcgcacggagctg
gtctttggccttgccttgaaggaggtcaaccccaccactcactcctacatcctcgtcagc
atgctaggccccaacgatggaaaccagagcagtgcctggacccttccaaggaatgggctt
ctgatgcctctactgagtgtgatcttcttaaatggcaactgtgcccgtgaagaggaaatc
tgggaattcctgaatatgctggggatctatgatggaaagaggcaccttatctttggggaa
ccccgaaagctcatcacccaagatctggtacaggaaaaatatctggaataccagcaggtg
cccaacagtgatcccccacgctatcaattcctgtggggtccaagagctcatgcagaaacc
agcaagatgaaagtcctggagtttttggccaaggtgaatgacaccacccccaataacttc
ccactgctttatgaagaggctttgagagatgaagaagagagagctggagcccggcccaga
gttgcagccaggcgtggcactacagccatgactagtgcgtattccagggccacatccagt
agctcttcccaacccatgtga

DBGET integrated database retrieval system