KEGG   Homo sapiens (human): 4116Help
Entry
4116              CDS       T01001                                 

Gene name
MAGOH, MAGOH1, MAGOHA
Definition
(RefSeq) mago homolog, exon junction complex subunit
  KO
K12877  protein mago nashi
Organism
hsa  Homo sapiens (human)
Pathway
hsa03013  RNA transport
hsa03015  mRNA surveillance pathway
hsa03040  Spliceosome
Module
hsa_M00430  Exon junction complex (EJC)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Transcription
   03040 Spliceosome
    4116 (MAGOH)
  Translation
   03013 RNA transport
    4116 (MAGOH)
   03015 mRNA surveillance pathway
    4116 (MAGOH)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    EJC complex
     4116 (MAGOH)
Spliceosome [BR:hsa03041]
 Complex C
  Other components
   EJC/TREX
    4116 (MAGOH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Mago_nashi
Motif
Other DBs
NCBI-GeneID: 4116
NCBI-ProteinID: NP_002361
OMIM: 602603
HGNC: 6815
Ensembl: ENSG00000162385
Vega: OTTHUMG00000008932
Pharos: P61326(Tbio)
UniProt: P61326
Structure
PDB: 

Position
1p32.3
AA seq 146 aa AA seqDB search
MESDFYLRYYVGHKGKFGHEFLEFEFRPDGKLRYANNSNYKNDVMIRKEAYVHKSVMEEL
KRIIDDSEITKEDDALWPPPDRVGRQELEIVIGDEHISFTTSKIGSLIDVNQSKDPEGLR
VFYYLVQDLKCLVFSLIGLHFKIKPI
NT seq 441 nt NT seq  +upstreamnt  +downstreamnt
atggagagtgacttttatctgcgttactacgtggggcacaagggcaagttcggccacgag
ttcctggagtttgagtttcgaccggacgggaagttaagatatgccaacaacagcaattac
aagaatgatgtcatgatcagaaaagaggcttatgtacataaaagcgtgatggaggaactg
aagagaataattgacgacagtgaaattaccaaagaggatgatgcattgtggcctcctcct
gaccgagtgggccggcaggagcttgaaatcgtcattggagatgaacacatttcttttaca
acatcaaaaattggttcccttattgatgtcaatcaatccaaggatccagaaggcttacga
gtattttattatcttgtccaggacctgaagtgtttggtcttcagtcttattggattacac
ttcaagattaaaccaatctag

DBGET integrated database retrieval system