KEGG   Homo sapiens (human): 4125Help
Entry
4125              CDS       T01001                                 

Gene name
MAN2B1, LAMAN, MANB
Definition
(RefSeq) mannosidase alpha class 2B member 1
  KO
K12311  lysosomal alpha-mannosidase [EC:3.2.1.24]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00511  Other glycan degradation
hsa04142  Lysosome
Disease
H00139  alpha-Mannosidosis
H00422  Glycoproteinoses
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    4125 (MAN2B1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    4125 (MAN2B1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.24  alpha-mannosidase
     4125 (MAN2B1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_38N Glyco_hydro_38C Alpha-mann_mid Glyco_hydro38C2
Motif
Other DBs
NCBI-GeneID: 4125
NCBI-ProteinID: NP_000519
OMIM: 609458
HGNC: 6826
Ensembl: ENSG00000104774
Vega: OTTHUMG00000156397
Pharos: O00754(Tchem)
UniProt: O00754
Position
19p13.13
AA seq 1011 aa AA seqDB search
MGAYARASGVCARGCLDSAGPWTMSRALRPPLPPLCFFLLLLAAAGARAGGYETCPTVQP
NMLNVHLLPHTHDDVGWLKTVDQYFYGIKNDIQHAGVQYILDSVISALLADPTRRFIYVE
IAFFSRWWHQQTNATQEVVRDLVRQGRLEFANGGWVMNDEAATHYGAIVDQMTLGLRFLE
DTFGNDGRPRVAWHIDPFGHSREQASLFAQMGFDGFFFGRLDYQDKWVRMQKLEMEQVWR
ASTSLKPPTADLFTGVLPNGYNPPRNLCWDVLCVDQPLVEDPRSPEYNAKELVDYFLNVA
TAQGRYYRTNHTVMTMGSDFQYENANMWFKNLDKLIRLVNAQQAKGSSVHVLYSTPACYL
WELNKANLTWSVKHDDFFPYADGPHQFWTGYFSSRPALKRYERLSYNFLQVCNQLEALVG
LAANVGPYGSGDSAPLNEAMAVLQHHDAVSGTSRQHVANDYARQLAAGWGPCEVLLSNAL
ARLRGFKDHFTFCQQLNISICPLSQTAARFQVIVYNPLGRKVNWMVRLPVSEGVFVVKDP
NGRTVPSDVVIFPSSDSQAHPPELLFSASLPALGFSTYSVAQVPRWKPQARAPQPIPRRS
WSPALTIENEHIRATFDPDTGLLMEIMNMNQQLLLPVRQTFFWYNASIGDNESDQASGAY
IFRPNQQKPLPVSRWAQIHLVKTPLVQEVHQNFSAWCSQVVRLYPGQRHLELEWSVGPIP
VGDTWGKEVISRFDTPLETKGRFYTDSNGREILERRRDYRPTWKLNQTEPVAGNYYPVNT
RIYITDGNMQLTVLTDRSQGGSSLRDGSLELMVHRRLLKDDGRGVSEPLMENGSGAWVRG
RHLVLLDTAQAAAAGHRLLAEQEVLAPQVVLAPGGGAAYNLGAPPRTQFSGLRRDLPPSV
HLLTLASWGPEMVLLRLEHQFAVGEDSGRNLSAPVTLNLRDLFSTFTITRLQETTLVANQ
LREAASRLKWTTNTGPTPHQTPYQLDPANITLEPMEIRTFLASVQWKEVDG
NT seq 3036 nt NT seq  +upstreamnt  +downstreamnt
atgggcgcctacgcgcgggcttcgggggtctgcgctcgcggctgcctggactcagcaggc
ccctggaccatgtcccgcgccctgcggccaccgctcccgcctctctgctttttccttttg
ttgctggcggctgccggtgctcgggccgggggatacgagacatgccccacagtgcagccg
aacatgctgaacgtgcacctgctgcctcacacacatgatgacgtgggctggctcaaaacc
gtggaccagtacttttatggaatcaagaatgacatccagcacgccggtgtgcagtacatc
ctggactcggtcatctctgccttgctggcagatcccacccgtcgcttcatttacgtggag
attgccttcttctcccgttggtggcaccagcagacaaatgccacacaggaagtcgtgcga
gaccttgtgcgccaggggcgcctggagttcgccaatggtggctgggtgatgaacgatgag
gcagccacccactacggtgccatcgtggaccagatgacacttgggctgcgctttctggag
gacacatttggcaatgatgggcgaccccgtgtggcctggcacattgaccccttcggccac
tctcgggagcaggcctcgctgtttgcgcagatgggcttcgacggcttcttctttgggcgc
cttgattatcaagataagtgggtacggatgcagaagctggagatggagcaggtgtggcgg
gccagcaccagcctgaagcccccgaccgcggacctcttcactggtgtgcttcccaatggt
tacaacccgccaaggaatctgtgctgggatgtgctgtgtgtcgatcagccgctggtggag
gaccctcgcagccccgagtacaacgccaaggagctggtcgattacttcctaaatgtggcc
actgcccagggccggtattaccgcaccaaccacactgtgatgaccatgggctcggacttc
caatatgagaatgccaacatgtggttcaagaaccttgacaagctcatccggctggtaaat
gcgcagcaggcaaaaggaagcagtgtccatgttctctactccacccccgcttgttacctc
tgggagctgaacaaggccaacctcacctggtcagtgaaacatgacgacttcttcccttac
gcggatggcccccaccagttctggaccggttacttttccagtcggccggccctcaaacgc
tacgagcgcctcagctacaacttcctgcaggtgtgcaaccagctggaggcgctggtgggc
ctggcggccaacgtgggaccctatggctccggagacagtgcacccctcaatgaggcgatg
gctgtgctccagcatcacgacgccgtcagcggcacctcccgccagcacgtggccaacgac
tacgcgcgccagcttgcggcaggctgggggccttgcgaggttcttctgagcaacgcgctg
gcgcggctcagaggcttcaaagatcacttcaccttttgccaacagctaaacatcagcatc
tgcccgctcagccagacggcggcgcgcttccaggtcatcgtttataatcccctggggcgg
aaggtgaattggatggtacggctgccggtcagcgaaggcgttttcgttgtgaaggacccc
aatggcaggacagtgcccagcgatgtggtaatatttcccagctcagacagccaggcgcac
cctccggagctgctgttctcagcctcactgcccgccctgggcttcagcacctattcagta
gcccaggtgcctcgctggaagccccaggcccgcgcaccacagcccatccccagaagatcc
tggtcccctgctttaaccatcgaaaatgagcacatccgggcaacgtttgatcctgacaca
gggctgttgatggagattatgaacatgaatcagcaactcctgctgcctgttcgccagacc
ttcttctggtacaacgccagtataggtgacaacgaaagtgaccaggcctcaggtgcctac
atcttcagacccaaccaacagaaaccgctgcctgtgagccgctgggctcagatccacctg
gtgaagacacccttggtgcaggaggtgcaccagaacttctcagcttggtgttcccaggtg
gttcgcctgtacccaggacagcggcacctggagctagagtggtcggtggggccgatacct
gtgggcgacacctgggggaaggaggtcatcagccgttttgacacaccgctggagacaaag
ggacgcttctacacagacagcaatggccgggagatcctggagaggaggcgggattatcga
cccacctggaaactgaaccagacggagcccgtggcaggaaactactatccagtcaacacc
cggatttacatcacggatggaaacatgcagctgactgtgctgactgaccgctcccagggg
ggcagcagcctgagagatggctcgctggagctcatggtgcaccgaaggctgctgaaggac
gatggacgcggagtatcggagccactaatggagaacgggtcgggggcgtgggtgcgaggg
cgccacctggtgctgctggacacagcccaggctgcagccgccggacaccggctcctggcg
gagcaggaggtcctggcccctcaggtggtgctggccccgggtggcggcgccgcctacaat
ctcggggctcctccgcgcacgcagttctcagggctgcgcagggacctgccgccctcggtg
cacctgctcacgctggccagctggggccccgaaatggtgctgctgcgcttggagcaccag
tttgccgtaggagaggattccggacgtaacctgagcgcccccgttaccttgaacttgagg
gacctgttctccaccttcaccatcacccgcctgcaggagaccacgctggtggccaaccag
ctccgcgaggcagcctccaggctcaagtggacaacaaacacaggccccacaccccaccaa
actccgtaccagctggacccggccaacatcacgctggaacccatggaaatccgcactttc
ctggcctcagttcaatggaaggaggtggatggttag

DBGET integrated database retrieval system