KEGG   Homo sapiens (human): 4129Help
Entry
4129              CDS       T01001                                 

Gene name
MAOB
Definition
(RefSeq) monoamine oxidase B
  KO
K00274  monoamine oxidase [EC:1.4.3.4]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00260  Glycine, serine and threonine metabolism
hsa00330  Arginine and proline metabolism
hsa00340  Histidine metabolism
hsa00350  Tyrosine metabolism
hsa00360  Phenylalanine metabolism
hsa00380  Tryptophan metabolism
hsa00982  Drug metabolism - cytochrome P450
hsa01100  Metabolic pathways
hsa04726  Serotonergic synapse
hsa04728  Dopaminergic synapse
hsa05030  Cocaine addiction
hsa05031  Amphetamine addiction
hsa05034  Alcoholism
Module
hsa_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Drug target
Caroxazone: D03409
Etryptamine acetate: D04092
Iproclozide: D07338
Iproniazide (DG00950): D02579 D08085
Isocarboxazid: D02580
Ladostigil tartrate: D03239
Lazabemide (DG01259): D01097 D04681
Milacemide hydrochloride: D05033
Mofegiline hydrochloride: D03733
Nialamide: D07337
Pargyline (DG00264): D02564 D08453
Phenelzine (DG00948): D00505 D08349
Phentermine (DG00102): D05458 D05459
Rasagiline (DG00865): D02562 D08469 D10829
Safinamide (DG01260): D10158 D10191
Safrazine hydrochloride: D01888
Selegiline (DG00864): D00785 D03731
Tranylcypromine (DG00949): D00826 D08625
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    4129 (MAOB)
   00330 Arginine and proline metabolism
    4129 (MAOB)
   00340 Histidine metabolism
    4129 (MAOB)
   00350 Tyrosine metabolism
    4129 (MAOB)
   00360 Phenylalanine metabolism
    4129 (MAOB)
   00380 Tryptophan metabolism
    4129 (MAOB)
  09111 Xenobiotics biodegradation and metabolism
   00982 Drug metabolism - cytochrome P450
    4129 (MAOB)
 09150 Organismal Systems
  09156 Nervous system
   04728 Dopaminergic synapse
    4129 (MAOB)
   04726 Serotonergic synapse
    4129 (MAOB)
 09160 Human Diseases
  09165 Substance dependence
   05030 Cocaine addiction
    4129 (MAOB)
   05031 Amphetamine addiction
    4129 (MAOB)
   05034 Alcoholism
    4129 (MAOB)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.4  monoamine oxidase
     4129 (MAOB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 DAO FAD_oxidored FAD_binding_2 FAD_binding_3 Thi4 Pyr_redox_2 Pyr_redox HI0933_like AlaDh_PNT_C Pyr_redox_3 GIDA IlvN Lycopene_cycl MCRA Trp_halogenase
Motif
Other DBs
NCBI-GeneID: 4129
NCBI-ProteinID: NP_000889
OMIM: 309860
HGNC: 6834
Ensembl: ENSG00000069535
Vega: OTTHUMG00000021388
Pharos: P27338(Tclin)
UniProt: P27338
Structure
PDB: 

Position
Xp11.3
AA seq 520 aa AA seqDB search
MSNKCDVVVVGGGISGMAAAKLLHDSGLNVVVLEARDRVGGRTYTLRNQKVKYVDLGGSY
VGPTQNRILRLAKELGLETYKVNEVERLIHHVKGKSYPFRGPFPPVWNPITYLDHNNFWR
TMDDMGREIPSDAPWKAPLAEEWDNMTMKELLDKLCWTESAKQLATLFVNLCVTAETHEV
SALWFLWYVKQCGGTTRIISTTNGGQERKFVGGSGQVSERIMDLLGDRVKLERPVIYIDQ
TRENVLVETLNHEMYEAKYVISAIPPTLGMKIHFNPPLPMMRNQMITRVPLGSVIKCIVY
YKEPFWRKKDYCGTMIIDGEEAPVAYTLDDTKPEGNYAAIMGFILAHKARKLARLTKEER
LKKLCELYAKVLGSLEALEPVHYEEKNWCEEQYSGGCYTTYFPPGILTQYGRVLRQPVDR
IYFAGTETATHWSGYMEGAVEAGERAAREILHAMGKIPEDEIWQSEPESVDVPAQPITTT
FLERHLPSVPGLLRLIGLTTIFSATALGFLAHKRGLLVRV
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgagcaacaaatgcgacgtggtcgtggtggggggcggcatctcaggtatggcagcagcc
aaacttctgcatgactctggactgaatgtggttgttctggaagcccgggaccgtgtggga
ggcaggacttacactcttaggaaccaaaaggttaaatatgtggaccttggaggatcctat
gttggaccaacccagaatcgtatcttgagattagccaaggagctaggattggagacctac
aaagtgaatgaggttgagcgtctgatccaccatgtaaagggcaaatcataccccttcagg
gggccattcccacctgtatggaatccaattacctacttagatcataacaacttttggagg
acaatggatgacatggggcgagagattccgagtgatgccccatggaaggctccccttgca
gaagagtgggacaacatgacaatgaaggagctactggacaagctctgctggactgaatct
gcaaagcagcttgccactctctttgtgaacctgtgtgtcactgcagagacccatgaggtc
tctgctctctggttcctgtggtatgtgaagcagtgtggaggcacaacaagaatcatctcg
acaacaaatggaggacaggagaggaaatttgtgggcggatctggtcaagtgagtgagcgg
ataatggacctccttggagaccgagtgaagctggagaggcctgtgatctacattgaccag
acaagagaaaatgtccttgtggagaccctaaaccatgagatgtatgaggctaaatatgtg
attagtgctattcctcctactctgggcatgaagattcacttcaatccccctctgccaatg
atgagaaaccagatgatcactcgtgtgcctttgggttcagtcatcaagtgtatagtttat
tataaagagcctttctggaggaaaaaggattactgtggaaccatgattattgatggagaa
gaagctccagttgcctacacgttggatgataccaaacctgaaggcaactatgctgccata
atgggatttatcctggcccacaaagccagaaaactggcacgtcttaccaaagaggaaagg
ttgaagaaactttgtgaactctatgccaaggttctgggttccctagaagctctggagcca
gtgcattatgaagaaaagaactggtgtgaggagcagtactctgggggctgctacacaact
tatttcccccctgggatcctgactcaatatggaagggttctacgccagccagtggacagg
atttactttgcaggcaccgagactgccacacactggagcggctacatggagggggctgta
gaggccggggagagagcagcccgagagatcctgcatgccatggggaagattccagaggat
gaaatctggcagtcagaaccagagtctgtggatgtccctgcacagcccatcaccaccacc
tttttggagagacatttgccctccgtgccaggcctgctcaggctgattggattgaccacc
atcttttcagcaacggctcttggcttcctggcccacaaaagggggctacttgtgagagtc
taa

DBGET integrated database retrieval system