KEGG   Homo sapiens (human): 4137Help
Entry
4137              CDS       T01001                                 

Gene name
MAPT, DDPAC, FTDP-17, MAPTL, MSTD, MTBT1, MTBT2, PPND, PPP1R103, TAU
Definition
(RefSeq) microtubule associated protein tau
  KO
K04380  microtubule-associated protein tau
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa05010  Alzheimer disease
Disease
H00058  Amyotrophic lateral sclerosis (ALS)
H00077  Progressive supranuclear palsy
H00078  Frontotemporal lobar degeneration
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    4137 (MAPT)
 09160 Human Diseases
  09164 Neurodegenerative diseases
   05010 Alzheimer disease
    4137 (MAPT)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    4137 (MAPT)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    4137 (MAPT)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    4137 (MAPT)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     4137 (MAPT)
Membrane trafficking [BR:hsa04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    4137 (MAPT)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Microtubule-associated proteins (MAPs)
     4137 (MAPT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Tubulin-binding Tmemb_cc2
Motif
Other DBs
NCBI-GeneID: 4137
NCBI-ProteinID: NP_058519
OMIM: 157140
HGNC: 6893
Ensembl: ENSG00000186868
Vega: OTTHUMG00000168833
Pharos: P10636(Tchem)
UniProt: P10636 A0A024R9Y1
Structure
PDB: 

Position
17q21.31
AA seq 758 aa AA seqDB search
MAEPRQEFEVMEDHAGTYGLGDRKDQGGYTMHQDQEGDTDAGLKESPLQTPTEDGSEEPG
SETSDAKSTPTAEDVTAPLVDEGAPGKQAAAQPHTEIPEGTTAEEAGIGDTPSLEDEAAG
HVTQEPESGKVVQEGFLREPGPPGLSHQLMSGMPGAPLLPEGPREATRQPSGTGPEDTEG
GRHAPELLKHQLLGDLHQEGPPLKGAGGKERPGSKEEVDEDRDVDESSPQDSPPSKASPA
QDGRPPQTAAREATSIPGFPAEGAIPLPVDFLSKVSTEIPASEPDGPSVGRAKGQDAPLE
FTFHVEITPNVQKEQAHSEEHLGRAAFPGAPGEGPEARGPSLGEDTKEADLPEPSEKQPA
AAPRGKPVSRVPQLKARMVSKSKDGTGSDDKKAKTSTRSSAKTLKNRPCLSPKHPTPGSS
DPLIQPSSPAVCPEPPSSPKYVSSVTSRTGSSGAKEMKLKGADGKTKIATPRGAAPPGQK
GQANATRIPAKTPPAPKTPPSSGEPPKSGDRSGYSSPGSPGTPGSRSRTPSLPTPPTREP
KKVAVVRTPPKSPSSAKSRLQTAPVPMPDLKNVKSKIGSTENLKHQPGGGKVQIINKKLD
LSNVQSKCGSKDNIKHVPGGGSVQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQVEVKSEK
LDFKDRVQSKIGSLDNITHVPGGGNKKIETHKLTFRENAKAKTDHGAEIVYKSPVVSGDT
SPRHLSNVSSTGSIDMVDSPQLATLADEVSASLAKQGL
NT seq 2277 nt NT seq  +upstreamnt  +downstreamnt
atggctgagccccgccaggagttcgaagtgatggaagatcacgctgggacgtacgggttg
ggggacaggaaagatcaggggggctacaccatgcaccaagaccaagagggtgacacggac
gctggcctgaaagaatctcccctgcagacccccactgaggacggatctgaggaaccgggc
tctgaaacctctgatgctaagagcactccaacagcggaagatgtgacagcacccttagtg
gatgagggagctcccggcaagcaggctgccgcgcagccccacacggagatcccagaagga
accacagctgaagaagcaggcattggagacacccccagcctggaagacgaagctgctggt
cacgtgacccaagagcctgaaagtggtaaggtggtccaggaaggcttcctccgagagcca
ggccccccaggtctgagccaccagctcatgtccggcatgcctggggctcccctcctgcct
gagggccccagagaggccacacgccaaccttcggggacaggacctgaggacacagagggc
ggccgccacgcccctgagctgctcaagcaccagcttctaggagacctgcaccaggagggg
ccgccgctgaagggggcagggggcaaagagaggccggggagcaaggaggaggtggatgaa
gaccgcgacgtcgatgagtcctccccccaagactcccctccctccaaggcctccccagcc
caagatgggcggcctccccagacagccgccagagaagccaccagcatcccaggcttccca
gcggagggtgccatccccctccctgtggatttcctctccaaagtttccacagagatccca
gcctcagagcccgacgggcccagtgtagggcgggccaaagggcaggatgcccccctggag
ttcacgtttcacgtggaaatcacacccaacgtgcagaaggagcaggcgcactcggaggag
catttgggaagggctgcatttccaggggcccctggagaggggccagaggcccggggcccc
tctttgggagaggacacaaaagaggctgaccttccagagccctctgaaaagcagcctgct
gctgctccgcgggggaagcccgtcagccgggtccctcaactcaaagctcgcatggtcagt
aaaagcaaagacgggactggaagcgatgacaaaaaagccaagacatccacacgttcctct
gctaaaaccttgaaaaataggccttgccttagccccaaacaccccactcctggtagctca
gaccctctgatccaaccctccagccctgctgtgtgcccagagccaccttcctctcctaaa
tacgtctcttctgtcacttcccgaactggcagttctggagcaaaggagatgaaactcaag
ggggctgatggtaaaacgaagatcgccacaccgcggggagcagcccctccaggccagaag
ggccaggccaacgccaccaggattccagcaaaaaccccgcccgctccaaagacaccaccc
agctctggtgaacctccaaaatcaggggatcgcagcggctacagcagccccggctcccca
ggcactcccggcagccgctcccgcaccccgtcccttccaaccccacccacccgggagccc
aagaaggtggcagtggtccgtactccacccaagtcgccgtcttccgccaagagccgcctg
cagacagcccccgtgcccatgccagacctgaagaatgtcaagtccaagatcggctccact
gagaacctgaagcaccagccgggaggcgggaaggtgcagataattaataagaagctggat
cttagcaacgtccagtccaagtgtggctcaaaggataatatcaaacacgtcccgggaggc
ggcagtgtgcaaatagtctacaaaccagttgacctgagcaaggtgacctccaagtgtggc
tcattaggcaacatccatcataaaccaggaggtggccaggtggaagtaaaatctgagaag
cttgacttcaaggacagagtccagtcgaagattgggtccctggacaatatcacccacgtc
cctggcggaggaaataaaaagattgaaacccacaagctgaccttccgcgagaacgccaaa
gccaagacagaccacggggcggagatcgtgtacaagtcgccagtggtgtctggggacacg
tctccacggcatctcagcaatgtctcctccaccggcagcatcgacatggtagactcgccc
cagctcgccacgctagctgacgaggtgtctgcctccctggccaagcagggtttgtga

DBGET integrated database retrieval system