KEGG   Homo sapiens (human): 414
Entry
414               CDS       T01001                                 

Gene name
ARSD, ASD
Definition
(RefSeq) arylsulfatase D
  KO
K12374  arylsulfatase D/F/H [EC:3.1.6.-]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    414 (ARSD)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.6  Sulfuric-ester hydrolases
    3.1.6.-  
     414 (ARSD)
SSDB
Motif
Pfam: Sulfatase Sulfatase_C Phosphodiest
Other DBs
NCBI-GeneID: 414
NCBI-ProteinID: NP_001660
OMIM: 300002
HGNC: 717
Ensembl: ENSG00000006756
Vega: OTTHUMG00000021077
Pharos: P51689(Tbio)
UniProt: P51689 A0A140VK06
Position
Xp22.33
AA seq 593 aa
MRSAARRGRAAPAARDSLPVLLFLCLLLKTCEPKTANAFKPNILLIMADDLGTGDLGCYG
NNTLRTPNIDQLAEEGVRLTQHLAAAPLCTPSRAAFLTGRHSFRSGMDASNGYRALQWNA
GSGGLPENETTFARILQQHGYATGLIGKWHQGVNCASRGDHCHHPLNHGFDYFYGMPFTL
TNDCDPGRPPEVDAALRAQLWGYTQFLALGILTLAAGQTCGFFSVSARAVTGMAGVGCLF
FISWYSSFGFVRRWNCILMRNHDVTEQPMVLEKTASLMLKEAVSYIERHKHGPFLLFLSL
LHVHIPLVTTSAFLGKSQHGLYGDNVEEMDWLIGKVLNAIEDNGLKNSTFTYFTSDHGGH
LEARDGHSQLGGWNGIYKGGKGMGGWEGGIRVPGIFHWPGVLPAGRVIGEPTSLMDVFPT
VVQLVGGEVPQDRVIDGHSLVPLLQGAEARSAHEFLFHYCGQHLHAARWHQKDSGSVWKV
HYTTPQFHPEGAGACYGRGVCPCSGEGVTHHRPPLLFDLSRDPSEARPLTPDSEPLYHAV
IARVGAAVSEHRQTLSPVPQQFSMSNILWKPWLQPCCGHFPFCSCHEDGDGTP
NT seq 1782 nt   +upstreamnt  +downstreamnt
atgcgatccgccgcgcggaggggacgcgccgcgcccgccgccagggactctttgccggtg
ctactgtttttatgcttgcttctgaagacgtgtgaacctaaaactgcaaatgcctttaaa
ccaaatatcctactgatcatggcggatgatctaggcactggggatctcggttgctacggg
aacaatacactgagaacgccgaatattgaccagcttgcagaggaaggtgtgaggctcact
cagcacctggcggccgccccgctctgcaccccaagccgagctgcattcctcacagggaga
cattccttcagatcaggcatggacgccagcaatggataccgggcccttcagtggaacgca
ggctcaggtggactccctgagaacgaaaccacttttgcaagaatcttgcagcagcatggc
tatgcaaccggcctcataggaaaatggcaccagggtgtgaattgtgcatcccgcggggat
cactgccaccaccccctgaaccacggatttgactatttctacggcatgcccttcacgctc
acaaacgactgtgacccaggcaggccccccgaagtggacgccgccctgagggcgcagctc
tggggttacacccagttcctggcgctggggattctcaccctggctgccggccagacctgc
ggtttcttctctgtctccgcgagagcagtcaccggcatggccggcgtgggctgcctgttt
ttcatctcttggtactcctccttcgggtttgtgcgacgctggaactgtatcctgatgaga
aaccatgacgtcacggagcaacccatggttctggagaaaacagcgagtcttatgctaaag
gaagctgtttcctatattgaaagacacaagcatgggccatttctcctcttcctttctttg
ctgcatgtgcacattccccttgtgaccacgagtgcattcctggggaaaagtcagcatggc
ttatatggtgataatgtggaggagatggactggctcataggtaaggttcttaatgccatc
gaagacaatggtttaaagaactcaacattcacgtatttcacctctgaccatggaggacat
ttagaggcaagagatggacacagccagttagggggatggaacggaatttacaaaggtggg
aagggcatgggaggatgggaaggtgggatccgcgtgcccgggatcttccactggccgggg
gtgctcccggccggccgagtgattggagagcccacgagcctgatggacgtgttccctact
gtggtccagctggtgggtggcgaggtgccccaggacagggtgattgatggccacagcctg
gtacccttgctgcagggagctgaggcacgctcggcacatgagttcctgtttcattactgt
gggcagcatcttcacgcagcacgctggcaccagaaggacagtggaagcgtctggaaggtt
cattacacgaccccgcagttccaccccgagggagcgggggcctgctacggccgaggcgtc
tgcccatgctccggggagggcgtgacccatcacagaccccctttgctctttgacctctcc
agggacccctccgaggcacggcccctgacccccgactccgagcccctgtaccacgccgtg
atagcaagggtaggtgccgcggtgtcggagcatcggcagaccctgagtcctgtgccccag
cagttttccatgagcaacatcctgtggaagccgtggctgcagccgtgctgcggacatttc
ccgttctgttcatgccacgaggatggggatggcaccccctga

DBGET integrated database retrieval system