KEGG   Homo sapiens (human): 4140Help
Entry
4140              CDS       T01001                                 

Gene name
MARK3, CTAK1, KP78, PAR1A, Par-1a, VIPB
Definition
(RefSeq) microtubule affinity regulating kinase 3
  KO
K08798  MAP/microtubule affinity-regulating kinase [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    4140 (MARK3)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    4140 (MARK3)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     4140 (MARK3)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: CAMK group
  CAMKL family
   4140 (MARK3)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Others
     4140 (MARK3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr KA1 Kinase-like UBA RIO1 UBA_2 Kdo Haspin_kinase APH
Motif
Other DBs
NCBI-GeneID: 4140
NCBI-ProteinID: NP_001122390
OMIM: 602678
HGNC: 6897
Ensembl: ENSG00000075413
Vega: OTTHUMG00000171789
Pharos: P27448(Tchem)
UniProt: P27448 Q86U11
Structure
PDB: 

Position
14q32.32-q32.33
AA seq 753 aa AA seqDB search
MSTRTPLPTVNERDTENHTSHGDGRQEVTSRTSRSGARCRNSIASCADEQPHIGNYRLLK
TIGKGNFAKVKLARHILTGREVAIKIIDKTQLNPTSLQKLFREVRIMKILNHPNIVKLFE
VIETEKTLYLIMEYASGGEVFDYLVAHGRMKEKEARSKFRQIVSAVQYCHQKRIVHRDLK
AENLLLDADMNIKIADFGFSNEFTVGGKLDTFCGSPPYAAPELFQGKKYDGPEVDVWSLG
VILYTLVSGSLPFDGQNLKELRERVLRGKYRIPFYMSTDCENLLKRFLVLNPIKRGTLEQ
IMKDRWINAGHEEDELKPFVEPELDISDQKRIDIMVGMGYSQEEIQESLSKMKYDEITAT
YLLLGRKSSELDASDSSSSSNLSLAKVRPSSDLNNSTGQSPHHKVQRSVSSSQKQRRYSD
HAGPAIPSVVAYPKRSQTSTADSDLKEDGISSRKSSGSAVGGKGIAPASPMLGNASNPNK
ADIPERKKSSTVPSSNTASGGMTRRNTYVCSERTTADRHSVIQNGKENSTIPDQRTPVAS
THSISSAATPDRIRFPRGTASRSTFHGQPRERRTATYNGPPASPSLSHEATPLSQTRSRG
STNLFSKLTSKLTRRNMSFRFIKRLPTEYERNGRYEGSSRNVSAEQKDENKEAKPRSLRF
TWSMKTTSSMDPGDMMREIRKVLDANNCDYEQRERFLLFCVHGDGHAENLVQWEMEVCKL
PRLSLNGVRFKRISGTSIAFKNIASKIANELKL
NT seq 2262 nt NT seq  +upstreamnt  +downstreamnt
atgtccactaggaccccattgccaacggtgaatgaacgagacactgaaaaccacacgtca
catggagatgggcgtcaagaagttacctctcgtaccagccgctcaggagctcggtgtaga
aactctatagcctcctgtgcagatgaacaacctcacatcggaaactacagactgttgaaa
acaatcggcaaggggaattttgcaaaagtaaaattggcaagacatatccttacaggcaga
gaggttgcaataaaaataattgacaaaactcagttgaatccaacaagtctacaaaagctc
ttcagagaagtaagaataatgaagattttaaatcatcccaatatagtgaagttattcgaa
gtcattgaaactgaaaaaacactctacctaatcatggaatatgcaagtggaggtgaagta
tttgactatttggttgcacatggcaggatgaaggaaaaagaagcaagatctaaatttaga
cagattgtgtctgcagttcaatactgccatcagaaacggatcgtacatcgagacctcaag
gctgaaaatctattgttagatgccgatatgaacattaaaatagcagatttcggttttagc
aatgaatttactgttggcggtaaactcgacacgttttgtggcagtcctccatacgcagca
cctgagctcttccagggcaagaaatatgacgggccagaagtggatgtgtggagtctgggg
gtcattttatacacactagtcagtggctcacttccctttgatgggcaaaacctaaaggaa
ctgagagagagagtattaagagggaaatacagaattcccttctacatgtctacagactgt
gaaaaccttctcaaacgtttcctggtgctaaatccaattaaacgcggcactctagagcaa
atcatgaaggacaggtggatcaatgcagggcatgaagaagatgaactcaaaccatttgtt
gaaccagagctagacatctcagaccaaaaaagaatagatattatggtgggaatgggatat
tcacaagaagaaattcaagaatctcttagtaagatgaaatacgatgaaatcacagctaca
tatttgttattggggagaaaatcttcagagctggatgctagtgattccagttctagcagc
aatctttcacttgctaaggttaggccgagcagtgatctcaacaacagtactggccagtct
cctcaccacaaagtgcagagaagtgtttcttcaagccaaaagcaaagacgctacagtgac
catgctggaccagctattccttctgttgtggcgtatccgaaaaggagtcagaccagcact
gcagatagtgacctcaaagaagatggaatttcctcccggaaatcaagtggcagtgctgtt
ggaggaaagggaattgctccagccagtcccatgcttgggaatgcaagtaatcctaataag
gcggatattcctgaacgcaagaaaagctccactgtccctagtagtaacacagcatctggt
ggaatgacacgacgaaatacttatgtttgcagtgagagaactacagctgatagacactca
gtgattcagaatggcaaagaaaacagcactattcctgatcagagaactccagttgcttca
acacacagtatcagtagtgcagccaccccagatcgaatccgcttcccaagaggcactgcc
agtcgtagcactttccacggccagccccgggaacggcgaaccgcaacatataatggccct
cctgcctctcccagcctgtcccatgaagccacaccattgtcccagactcgaagccgaggc
tccactaatctctttagtaaattaacttcaaaactcacaaggagaaacatgtcattcagg
tttatcaaaaggcttccaactgaatatgagaggaacgggagatatgagggctcaagtcgc
aatgtatctgctgagcaaaaagatgaaaacaaagaagcaaagcctcgatccctacgcttc
acctggagcatgaaaaccactagttcaatggatcccggggacatgatgcgggaaatccgc
aaagtgttggacgccaataactgcgactatgagcagagggagcgcttcttgctcttctgc
gtccacggagatgggcacgcggagaacctcgtgcagtgggaaatggaagtgtgcaagctg
ccaagactgtctctgaacggggtccggtttaagcggatatcggggacatccatagccttc
aaaaatattgcttccaaaattgccaatgagctaaagctgtaa

DBGET integrated database retrieval system