KEGG   Homo sapiens (human): 414062Help
Entry
414062            CDS       T01001                                 

Gene name
CCL3L3, 464.2, D17S1718, G0S19-2, LD78, LD78BETA, SCYA3L, SCYA3L1
Definition
(RefSeq) C-C motif chemokine ligand 3 like 3
  KO
K05408  C-C motif chemokine 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04062  Chemokine signaling pathway
hsa04620  Toll-like receptor signaling pathway
hsa05132  Salmonella infection
hsa05142  Chagas disease (American trypanosomiasis)
hsa05163  Human cytomegalovirus infection
hsa05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    414062 (CCL3L3)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    414062 (CCL3L3)
   04062 Chemokine signaling pathway
    414062 (CCL3L3)
 09160 Human Diseases
  09163 Immune disease
   05323 Rheumatoid arthritis
    414062 (CCL3L3)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    414062 (CCL3L3)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    414062 (CCL3L3)
  09174 Infectious disease: parasitic
   05142 Chagas disease (American trypanosomiasis)
    414062 (CCL3L3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    414062 (CCL3L3)
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    414062 (CCL3L3)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Chemokines
   414062 (CCL3L3)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate/Haparin
  Chemokines
   414062 (CCL3L3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL8
Motif
Other DBs
NCBI-GeneID: 414062
NCBI-ProteinID: NP_001001437
OMIM: 609468
HGNC: 30554
Ensembl: ENSG00000276085
Vega: OTTHUMG00000188419
UniProt: P16619
Position
17q12
AA seq 93 aa AA seqDB search
MQVSTAALAVLLCTMALCNQVLSAPLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSK
PSVIFLTKRGRQVCADPSEEWVQKYVSDLELSA
NT seq 282 nt NT seq  +upstreamnt  +downstreamnt
atgcaggtctccactgctgcccttgccgtcctcctctgcaccatggctctctgcaaccag
gtcctctctgcaccacttgctgctgacacgccgaccgcctgctgcttcagctacacctcc
cgacagattccacagaatttcatagctgactactttgagacgagcagccagtgctccaag
cccagtgtcatcttcctaaccaagagaggccggcaggtctgtgctgaccccagtgaggag
tgggtccagaaatacgtcagtgacctggagctgagtgcctga

KEGG   Homo sapiens (human): 6348Help
Entry
6348              CDS       T01001                                 

Gene name
CCL3, G0S19-1, LD78ALPHA, MIP-1-alpha, MIP1A, SCYA3
Definition
(RefSeq) C-C motif chemokine ligand 3
  KO
K05408  C-C motif chemokine 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04062  Chemokine signaling pathway
hsa04620  Toll-like receptor signaling pathway
hsa05132  Salmonella infection
hsa05142  Chagas disease (American trypanosomiasis)
hsa05163  Human cytomegalovirus infection
hsa05323  Rheumatoid arthritis
Network
nt06124  Chemokine signaling (virus)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06167  Human cytomegalovirus (HCMV)
nt06224  CXCR signaling
  Element
N00153  CCR/CXCR-GNB/G-PI3K-RAC signaling pathway
N00406  HCMV US28 to GNA12/13-Rho signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    6348 (CCL3)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    6348 (CCL3)
   04062 Chemokine signaling pathway
    6348 (CCL3)
 09160 Human Diseases
  09163 Immune disease
   05323 Rheumatoid arthritis
    6348 (CCL3)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    6348 (CCL3)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    6348 (CCL3)
  09174 Infectious disease: parasitic
   05142 Chagas disease (American trypanosomiasis)
    6348 (CCL3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    6348 (CCL3)
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    6348 (CCL3)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Chemokines
   6348 (CCL3)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate/Haparin
  Chemokines
   6348 (CCL3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL8
Motif
Other DBs
NCBI-GeneID: 6348
NCBI-ProteinID: NP_002974
OMIM: 182283
HGNC: 10627
Ensembl: ENSG00000277632
Vega: OTTHUMG00000188413
Pharos: P10147(Tbio)
UniProt: P10147 A0N0R1
Structure
PDB: 

Position
17q12
AA seq 92 aa AA seqDB search
MQVSTAALAVLLCTMALCNQFSASLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKP
GVIFLTKRSRQVCADPSEEWVQKYVSDLELSA
NT seq 279 nt NT seq  +upstreamnt  +downstreamnt
atgcaggtctccactgctgcccttgctgtcctcctctgcaccatggctctctgcaaccag
ttctctgcatcacttgctgctgacacgccgaccgcctgctgcttcagctacacctcccgg
cagattccacagaatttcatagctgactactttgagacgagcagccagtgctccaagccc
ggtgtcatcttcctaaccaagcgaagccggcaggtctgtgctgaccccagtgaggagtgg
gtccagaaatatgtcagcgacctggagctgagtgcctga

KEGG   Homo sapiens (human): 6349Help
Entry
6349              CDS       T01001                                 

Gene name
CCL3L1, 464.2, D17S1718, G0S19-2, LD78, LD78-beta(1-70), LD78BETA, MIP1AP, SCYA3L, SCYA3L1
Definition
(RefSeq) C-C motif chemokine ligand 3 like 1
  KO
K05408  C-C motif chemokine 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04062  Chemokine signaling pathway
hsa04620  Toll-like receptor signaling pathway
hsa05132  Salmonella infection
hsa05142  Chagas disease (American trypanosomiasis)
hsa05163  Human cytomegalovirus infection
hsa05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    6349 (CCL3L1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    6349 (CCL3L1)
   04062 Chemokine signaling pathway
    6349 (CCL3L1)
 09160 Human Diseases
  09163 Immune disease
   05323 Rheumatoid arthritis
    6349 (CCL3L1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    6349 (CCL3L1)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    6349 (CCL3L1)
  09174 Infectious disease: parasitic
   05142 Chagas disease (American trypanosomiasis)
    6349 (CCL3L1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    6349 (CCL3L1)
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    6349 (CCL3L1)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Chemokines
   6349 (CCL3L1)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate/Haparin
  Chemokines
   6349 (CCL3L1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL8
Motif
Other DBs
NCBI-GeneID: 6349
NCBI-ProteinID: NP_066286
OMIM: 601395
HGNC: 10628
Pharos: P16619(Tbio)
UniProt: P16619
Position
17q21.1
AA seq 93 aa AA seqDB search
MQVSTAALAVLLCTMALCNQVLSAPLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSK
PSVIFLTKRGRQVCADPSEEWVQKYVSDLELSA
NT seq 282 nt NT seq  +upstreamnt  +downstreamnt
atgcaggtctccactgctgcccttgccgtcctcctctgcaccatggctctctgcaaccag
gtcctctctgcaccacttgctgctgacacgccgaccgcctgctgcttcagctacacctcc
cgacagattccacagaatttcatagctgactactttgagacgagcagccagtgctccaag
cccagtgtcatcttcctaaccaagagaggccggcaggtctgtgctgaccccagtgaggag
tgggtccagaaatacgtcagtgacctggagctgagtgcctga

DBGET integrated database retrieval system