KEGG   Homo sapiens (human): 4141Help
Entry
4141              CDS       T01001                                 

Gene name
MARS, CMT2U, ILFS2, ILLD, METRS, MRS, MTRNS, SPG70
Definition
(RefSeq) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00450  Selenocompound metabolism
hsa00970  Aminoacyl-tRNA biosynthesis
Module
hsa_M00359  Aminoacyl-tRNA biosynthesis, eukaryotes
Disease
H00264  Charcot-Marie-Tooth disease (CMT)
H02124  Interstitial lung and liver disease
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Metabolism of other amino acids
   00450 Selenocompound metabolism
    4141 (MARS)
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    4141 (MARS)
Enzymes [BR:hsa01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     4141 (MARS)
Amino acid related enzymes [BR:hsa01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   4141 (MARS)
Transfer RNA biogenesis [BR:hsa03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    4141 (MARS)
 Prokaryotic Type
   Other AARSs
    4141 (MARS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g WHEP-TRS tRNA-synt_1 GST_C GST_C_2 Anticodon_1 GST_C_3 GST_N_2 GST_N DUF16 Peptidase_C1_2
Motif
Other DBs
NCBI-GeneID: 4141
NCBI-ProteinID: NP_004981
OMIM: 156560
HGNC: 6898
Ensembl: ENSG00000166986
Vega: OTTHUMG00000169996
Pharos: P56192(Tchem)
UniProt: P56192
Structure
PDB: 

Position
12q13.3
AA seq 900 aa AA seqDB search
MRLFVSDGVPGCLPVLAAAGRARGRAEVLISTVGPEDCVVPFLTRPKVPVLQLDSGNYLF
STSAICRYFFLLSGWEQDDLTNQWLEWEATELQPALSAALYYLVVQGKKGEDVLGSVRRA
LTHIDHSLSRQNCPFLAGETESLADIVLWGALYPLLQDPAYLPEELSALHSWFQTLSTQE
PCQRAAETVLKQQGVLALRPYLQKQPQPSPAEGRAVTNEPEEEELATLSEEEIAMAVTAW
EKGLESLPPLRPQQNPVLPVAGERNVLITSALPYVNNVPHLGNIIGCVLSADVFARYSRL
RQWNTLYLCGTDEYGTATETKALEEGLTPQEICDKYHIIHADIYRWFNISFDIFGRTTTP
QQTKITQDIFQQLLKRGFVLQDTVEQLRCEHCARFLADRFVEGVCPFCGYEEARGDQCDK
CGKLINAVELKKPQCKVCRSCPVVQSSQHLFLDLPKLEKRLEEWLGRTLPGSDWTPNAQF
ITRSWLRDGLKPRCITRDLKWGTPVPLEGFEDKVFYVWFDATIGYLSITANYTDQWERWW
KNPEQVDLYQFMAKDNVPFHSLVFPCSALGAEDNYTLVSHLIATEYLNYEDGKFSKSRGV
GVFGDMAQDTGIPADIWRFYLLYIRPEGQDSAFSWTDLLLKNNSELLNNLGNFINRAGMF
VSKFFGGYVPEMVLTPDDQRLLAHVTLELQHYHQLLEKVRIRDALRSILTISRHGNQYIQ
VNEPWKRIKGSEADRQRAGTVTGLAVNIAALLSVMLQPYMPTVSATIQAQLQLPPPACSI
LLTNFLCTLPAGHQIGTVSPLFQKLENDQIESLRQRFGGGQAKTSPKPAVVETVTTAKPQ
QIQALMDEVTKQGNIVRELKAQKADKNEVAAEVAKLLDLKKQLAVAEGKPPEAPKGKKKK
NT seq 2703 nt NT seq  +upstreamnt  +downstreamnt
atgagactgttcgtgagtgatggcgtcccgggttgcttgccggtgctggccgccgccggg
agagcccggggcagagcagaggtgctcatcagcactgtaggcccggaagattgtgtggtc
ccgttcctgacccggcctaaggtccctgtcttgcagctggatagcggcaactacctcttc
tccactagtgcaatctgccgatatttttttttgttatctggctgggagcaagatgacctc
actaaccagtggctggaatgggaagcgacagagctgcagccagctttgtctgctgccctg
tactatttagtggtccaaggcaagaagggggaagatgttcttggttcagtgcggagagcc
ctgactcacattgaccacagcttgagtcgtcagaactgtcctttcctggctggggagaca
gaatctctagccgacattgttttgtggggagccctatacccattactgcaagatcccgcc
tacctccctgaggagctgagtgccctgcacagctggttccagacactgagtacccaggaa
ccatgtcagcgagctgcagagactgtactgaaacagcaaggtgtcctggctctccggcct
tacctccaaaagcagccccagcccagccccgctgagggaagggctgtcaccaatgagcct
gaggaggaggagctggctaccctatctgaggaggagattgctatggctgttactgcttgg
gagaagggcctagaaagtttgcccccgctgcggccccagcagaatccagtgttgcctgtg
gctggagaaaggaatgtgctcatcaccagtgccctcccttacgtcaacaatgtcccccac
cttgggaacatcattggttgtgtgctcagtgccgatgtctttgccaggtactctcgcctc
cgccagtggaacaccctctatctgtgtgggacagatgagtatggtacagcaacagagacc
aaggctctggaggagggactaaccccccaggagatctgcgacaagtaccacatcatccat
gctgacatctaccgctggtttaacatttcgtttgatatttttggtcgcaccaccactcca
cagcagaccaaaatcacccaggacattttccagcagttgctgaaacgaggttttgtgctg
caagatactgtggagcaactgcgatgtgagcactgtgctcgcttcctggctgaccgcttc
gtggagggcgtgtgtcccttctgtggctatgaggaggctcggggtgaccagtgtgacaag
tgtggcaagctcatcaatgctgtcgagcttaagaagcctcagtgtaaagtctgccgatca
tgccctgtggtgcagtcgagccagcacctgtttctggacctgcctaagctggagaagcga
ctggaggagtggttggggaggacattgcctggcagtgactggacacccaatgcccagttt
atcacccgttcttggcttcgggatggcctcaagccacgctgcataacccgagacctcaaa
tggggaacccctgtacccttagaaggttttgaagacaaggtattctatgtctggtttgat
gccactattggctatctgtccatcacagccaactacacagaccagtgggagagatggtgg
aagaacccagagcaagtggacctgtatcagttcatggccaaagacaatgttcctttccat
agcttagtctttccttgctcagccctaggagctgaggataactataccttggtcagccac
ctcattgctacagagtacctgaactatgaggatgggaaattctctaagagccgcggtgtg
ggagtgtttggggacatggcccaggacacggggatccctgctgacatctggcgcttctat
ctgctgtacattcggcctgagggccaggacagtgctttctcctggacggacctgctgctg
aagaataattctgagctgcttaacaacctgggcaacttcatcaacagagctgggatgttt
gtgtctaagttctttgggggctatgtgcctgagatggtgctcacccctgatgatcagcgc
ctgctggcccatgtcaccctggagctccagcactatcaccagctacttgagaaggttcgg
atccgggatgccttgcgcagtatcctcaccatatctcgacatggcaaccaatatattcag
gtgaatgagccctggaagcggattaaaggcagtgaggctgacaggcaacgggcaggaaca
gtgactggcttggcagtgaatatagctgccttgctctctgtcatgcttcagccttacatg
cccacggttagtgccacaatccaggcccagctgcagctcccacctccagcctgcagtatc
ctgctgacaaacttcctgtgtaccttaccagcaggacaccagattggcacagtcagtccc
ttgttccaaaaattggaaaatgaccagattgaaagtttaaggcagcgctttggagggggc
caggcaaaaacgtccccgaagccagcagttgtagagactgttacaacagccaagccacag
cagatacaagcgctgatggatgaagtgacaaaacaaggaaacattgtccgagaactgaaa
gcacaaaaggcagacaagaacgaggttgctgcggaggtggcgaaactcttggatctaaag
aaacagttggctgtagctgaggggaaaccccctgaagcccctaaaggcaagaagaaaaag
taa

DBGET integrated database retrieval system