KEGG   Homo sapiens (human): 414152
Entry
414152            CDS       T01001                                 
Symbol
C10orf105
Name
(RefSeq) chromosome 10 open reading frame 105
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: DUF5527
Other DBs
NCBI-GeneID: 414152
NCBI-ProteinID: NP_001157847
HGNC: 20304
Ensembl: ENSG00000214688
Pharos: Q8TEF2(Tdark)
UniProt: Q8TEF2
Position
10:complement(71711701..71737850)
AA seq 133 aa
MSTEGPSLASSPAISPLAFLSAPVTPGTLAEATDPLPMLIALACIFLLLATCLLFMTLCK
PAALDPSRRRAHECMPHHPGSPSEPQLRLWKRLGSLRLSLHSFRHGRPTVPRQPLPGPED
NRSHCDYMESTKM
NT seq 402 nt   +upstreamnt  +downstreamnt
atgagcacagagggccccagcctcgccagctccccagccatcagccccctcgcctttctc
tcagctcccgtcactcccgggacccttgcagaggcaactgaccccctccccatgctcatc
gccctggcctgcatcttcctcctgctggccacctgtctgctgttcatgacgctctgcaag
ccggccgcgctggacccgagccgccgcagggctcacgagtgcatgccccaccaccctggg
agccccagtgagccccagctccggctctggaagcgcctgggctccttgcgcctctccctg
cacagcttccgccatggccggcccaccgtccctcgacagcccctgccgggccccgaggac
aaccgcagccactgtgactacatggaatctaccaagatgtaa

DBGET integrated database retrieval system