KEGG   Homo sapiens (human): 414157
Entry
414157            CDS       T01001                                 
Symbol
C10orf62, bA548K23.1
Name
(RefSeq) chromosome 10 open reading frame 62
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: DUF5569
Other DBs
NCBI-GeneID: 414157
NCBI-ProteinID: NP_001009997
HGNC: 23294
Ensembl: ENSG00000203942
Pharos: Q5T681(Tdark)
UniProt: Q5T681
Position
10:97589721..97590934
AA seq 223 aa
MLWVQRKRRRKETSECPSDKDKSPESHKAKNESWIKSHFSRLSEEKLALDNNASASGNAT
QTESGSEEVSSTVHIETFTTRHGEVGSALHRESFTSRQKTSGPSVIQEIHQESGKAPSTD
EATWAAVAACTKEIDTQGRHLAHSMLQRAIAYQHSGHLESKDINQEELRALEEVEMKLQK
NFLTQRENTIAGANHTHTFYGHSHHSHHGHPSHQSHSLPNRRH
NT seq 672 nt   +upstreamnt  +downstreamnt
atgctgtgggttcagagaaagaggagaagaaaggaaacctctgagtgtccatcagacaag
gacaagtcaccagaatcccataaagcaaagaatgaaagctggattaaatcccactttagc
cgcctttccgaagagaagctggccctcgacaacaatgccagcgctagtggcaatgctacc
cagactgagagtgggagtgaagaggtcagctccacggttcacatagagaccttcaccacg
aggcacggagaagtgggctccgctctgcaccgggaatccttcaccagcaggcagaagaca
tctgggccctcagtgatccaagagatccaccaggagtctggaaaagccccatccactgat
gaggccacgtgggccgctgtggctgcctgcaccaaggagattgacacccaggggcggcac
ctggctcactccatgctgcagcgggccatagcttaccagcactcaggtcacctagagtcc
aaggacatcaaccaggaggagctgagggccctcgaggaggtagagatgaagctgcaaaag
aatttcctcacccagcgggaaaacaccatagctggtgccaatcacacacacaccttctat
ggccacagtcaccacagtcaccatggccacccaagccaccagagccacagcctgcctaat
cgcagacactag

DBGET integrated database retrieval system