KEGG   Homo sapiens (human): 4142Help
Entry
4142              CDS       T01001                                 

Gene name
MAS1, MAS, MGRA
Definition
(RefSeq) MAS1 proto-oncogene, G protein-coupled receptor
  KO
K04303  proto-oncogene Mas
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04614  Renin-angiotensin system
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    4142 (MAS1)
 09150 Organismal Systems
  09152 Endocrine system
   04614 Renin-angiotensin system
    4142 (MAS1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    4142 (MAS1)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Others
   Mas proto-oncogene and Mas-related (MRGs)
    4142 (MAS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srx 7TM_GPCR_Srbc
Motif
Other DBs
NCBI-GeneID: 4142
NCBI-ProteinID: NP_002368
OMIM: 165180
HGNC: 6899
Ensembl: ENSG00000130368
Vega: OTTHUMG00000015944
Pharos: P04201(Tbio)
UniProt: P04201 W8W3P4
Position
6q25.3
AA seq 325 aa AA seqDB search
MDGSNVTSFVVEEPTNISTGRNASVGNAHRQIPIVHWVIMSISPVGFVENGILLWFLCFR
MRRNPFTVYITHLSIADISLLFCIFILSIDYALDYELSSGHYYTIVTLSVTFLFGYNTGL
YLLTAISVERCLSVLYPIWYRCHRPKYQSALVCALLWALSCLVTTMEYVMCIDREEESHS
RNDCRAVIIFIAILSFLVFTPLMLVSSTILVVKIRKNTWASHSSKLYIVIMVTIIIFLIF
AMPMRLLYLLYYEYWSTFGNLHHISLLFSTINSSANPFIYFFVGSSKKKRFKESLKVVLT
RAFKDEMQPRRQKDNCNTVTVETVV
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atggatgggtcaaacgtgacatcatttgttgttgaggaacccacgaacatctcaactggc
aggaacgcctcagtcgggaatgcacatcggcaaatccccatcgtgcactgggtcattatg
agcatctccccagtggggtttgttgagaatgggattctcctctggttcctgtgcttccgg
atgagaagaaatcccttcactgtctacatcacccacctgtctatcgcagacatctcactg
ctcttctgtattttcatcttgtctatcgactatgctttagattatgagctttcttctggc
cattactacacaattgtcacattatcagtgacttttctgtttggctacaacacgggcctc
tatctgctgacggccattagtgtggagaggtgcctgtcagtcctttaccccatctggtac
cgatgccatcgccccaagtaccagtcggcattggtctgtgcccttctgtgggctctttct
tgcttggtgaccaccatggagtatgtcatgtgcatcgacagagaagaagagagtcactct
cggaatgactgccgagcagtcatcatctttatagccatcctgagcttcctggtcttcacg
cccctcatgctggtgtccagcaccatcttggtcgtgaagatccggaagaacacgtgggct
tcccattcctccaagctttacatagtcatcatggtcaccatcattatattcctcatcttc
gctatgcccatgagactcctttacctgctgtactatgagtattggtcgacctttgggaac
ctacaccacatttccctgctcttctccacaatcaacagtagcgccaaccctttcatttac
ttctttgtgggaagcagtaagaagaagagattcaaggagtccttaaaagttgttctgacc
agggctttcaaagatgaaatgcaacctcggcgccagaaagacaattgtaatacggtcaca
gttgagactgtcgtctaa

DBGET integrated database retrieval system