KEGG   Homo sapiens (human): 4145Help
Entry
4145              CDS       T01001                                 

Gene name
MATK, CHK, CTK, HHYLTK, HYL, HYLTK, Lsk
Definition
(RefSeq) megakaryocyte-associated tyrosine kinase
  KO
K08888  megakaryocyte-associated tyrosine kinase [EC:2.7.10.2]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04722  Neurotrophin signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    4145 (MATK)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    4145 (MATK)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     4145 (MATK)
Protein kinases [BR:hsa01001]
 Non-receptor tyrosine kinases
  CSK family
   4145 (MATK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase SH2 SH3_1 SH3_9 SH3_2 SH3_3 Kinase-like RIO1 Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 4145
NCBI-ProteinID: NP_647612
OMIM: 600038
HGNC: 6906
Ensembl: ENSG00000007264
Vega: OTTHUMG00000180916
Pharos: P42679(Tbio)
UniProt: P42679 F1T0G6
Structure
PDB: 

Position
19p13.3
AA seq 507 aa AA seqDB search
MAGRGSLVSWRAFHGCDSAEELPRVSPRFLRAWHPPPVSARMPTRRWAPGTQCITKCEHT
RPKPGELAFRKGDVVTILEACENKSWYRVKHHTSGQEGLLAAGALREREALSADPKLSLM
PWFHGKISGQEAVQQLQPPEDGLFLVRESARHPGDYVLCVSFGRDVIHYRVLHRDGHLTI
DEAVFFCNLMDMVEHYSKDKGAICTKLVRPKRKHGTKSAEEELARAGWLLNLQHLTLGAQ
IGEGEFGAVLQGEYLGQKVAVKNIKCDVTAQAFLDETAVMTKMQHENLVRLLGVILHQGL
YIVMEHVSKGNLVNFLRTRGRALVNTAQLLQFSLHVAEGMEYLESKKLVHRDLAARNILV
SEDLVAKVSDFGLAKAERKGLDSSRLPVKWTAPEALKHGKFTSKSDVWSFGVLLWEVFSY
GRAPYPKMSLKEVSEAVEKGYRMEPPEGCPGPVHVLMSSCWEAEPARRPPFRKLAEKLAR
ELRSAGAPASVSGQDADGSTSPRSQEP
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atggcggggcgaggctctctggtttcctggcgggcatttcacggctgtgattctgctgag
gaacttccccgggtgagcccccgcttcctccgagcctggcacccccctcccgtctcagcc
aggatgccaacgaggcgctgggccccgggcacccagtgtatcaccaaatgcgagcacacc
cgccccaagccaggggagctggccttccgcaagggcgacgtggtcaccatcctggaggcc
tgcgagaacaagagctggtaccgcgtcaagcaccacaccagtggacaggaggggctgctg
gcagctggggcgctgcgggagcgggaggccctctccgcagaccccaagctcagcctcatg
ccgtggttccacgggaagatctcgggccaggaggctgtccagcagctgcagcctcccgag
gatgggctgttcctggtgcgggagtccgcgcgccaccccggcgactacgtcctgtgcgtg
agctttggccgcgacgtcatccactaccgcgtgctgcaccgcgacggccacctcacaatc
gatgaggccgtgttcttctgcaacctcatggacatggtggagcattacagcaaggacaag
ggcgctatctgcaccaagctggtgagaccaaagcggaaacacgggaccaagtcggccgag
gaggagctggccagggcgggctggttactgaacctgcagcatttgacattgggagcacag
atcggagagggagagtttggagctgtcctgcagggtgagtacctggggcaaaaggtggcc
gtgaagaatatcaagtgtgatgtgacagcccaggccttcctggacgagacggccgtcatg
acgaagatgcaacacgagaacctggtgcgtctcctgggcgtgatcctgcaccaggggctg
tacattgtcatggagcacgtgagcaagggcaacctggtgaactttctgcggacccggggt
cgagccctcgtgaacaccgctcagctcctgcagttttctctgcacgtggccgagggcatg
gagtacctggagagcaagaagcttgtgcaccgcgacctggccgcccgcaacatcctggtc
tcagaggacctggtggccaaggtcagcgactttggcctggccaaagccgagcggaagggg
ctagactcaagccggctgcccgtcaagtggacggcgcccgaggctctcaaacacgggaag
ttcaccagcaagtcggatgtctggagttttggggtgctgctctgggaggtcttctcatat
ggacgggctccgtaccctaaaatgtcactgaaagaggtgtcggaggccgtggagaagggg
taccgcatggaaccccccgagggctgtccaggccccgtgcacgtcctcatgagcagctgc
tgggaggcagagcccgcccgccggccacccttccgcaaactggccgagaagctggcccgg
gagctacgcagtgcaggtgccccagcctccgtctcagggcaggacgccgacggctccacc
tcgccccgaagccaggagccctga

DBGET integrated database retrieval system