KEGG   Homo sapiens (human): 414899
Entry
414899            CDS       T01001                                 

Gene name
BLID, BRCC2
Definition
(RefSeq) BH3-like motif containing, cell death inducer
Organism
hsa  Homo sapiens (human)
SSDB
Other DBs
NCBI-GeneID: 414899
NCBI-ProteinID: NP_001001786
OMIM: 608853
HGNC: 33495
Ensembl: ENSG00000259571
Vega: OTTHUMG00000166060
Pharos: Q8IZY5(Tbio)
UniProt: Q8IZY5
Position
11q24.1
AA seq 108 aa
MVTLLPIEGQEIHFFEILESECVLYTGWIERASGSSIYPEAKARLPLEALLGSNKEPMLP
KETVLSLKRYNLGSSAMKRNVPGHVLQRPSYLTRIQVTLLCNSSAEAL
NT seq 327 nt   +upstreamnt  +downstreamnt
atggtgactttgttgcctatagagggccaggaaatacatttctttgagatcctagaatct
gagtgtgtgctctacacaggatggatagagcgagcctctggcagttccatttatccagag
gcaaaagcacgcctgccactggaggcgctcttgggttccaacaaagaacctatgttgcct
aaggaaacagtgctttctcttaaaaggtacaatcttggctcctctgccatgaagcggaat
gttcctggacatgtgcttcagagaccttcctatttaaccaggatacaagttacattgtta
tgcaattcctctgctgaggccctgtaa

DBGET integrated database retrieval system