KEGG   Homo sapiens (human): 4149Help
Entry
4149              CDS       T01001                                 

Gene name
MAX, bHLHd4
Definition
(RefSeq) MYC associated factor X
  KO
K04453  Max protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa05200  Pathways in cancer
hsa05202  Transcriptional misregulation in cancer
hsa05222  Small cell lung cancer
Network
N00088  Amplified MYC to p15-cell cycle G1/S
N00089  Amplified MYC to cell cycle G1/S
N00090  p15-Cell cycle G1/S
N00092  Amplified MYC to p27-cell cycle G1/S
N00131  Amplified MYCN to transcriptional activation
N00132  Amplified MYCN to transcriptional repression
Disease
H01510  Malignant paraganglioma
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    4149 (MAX)
 09160 Human Diseases
  09161 Cancers
   05200 Pathways in cancer
    4149 (MAX)
   05202 Transcriptional misregulation in cancers
    4149 (MAX)
   05222 Small cell lung cancer
    4149 (MAX)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    4149 (MAX)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Basic helix-loop-helix/leucine zipper (bHLH-ZIP)
   Cell cycle controlling factors, Mad/Max
    4149 (MAX)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HLH IncA Filament SlyX bZIP_2 Rab5-bind CREPT DUF5082 SLX9 ZapB DUF4763 ATG16 DivIC V_ATPase_I
Motif
Other DBs
NCBI-GeneID: 4149
NCBI-ProteinID: NP_002373
OMIM: 154950
HGNC: 6913
Ensembl: ENSG00000125952
Vega: OTTHUMG00000142809
Pharos: P61244(Tbio)
UniProt: P61244 Q8TAX8
Structure
PDB: 

Position
14q23.3
AA seq 160 aa AA seqDB search
MSDNDDIEVESDEEQPRFQSAADKRAHHNALERKRRDHIKDSFHSLRDSVPSLQGEKASR
AQILDKATEYIQYMRRKNHTHQQDIDDLKRQNALLEQQVRALEKARSSAQLQTNYPSSDN
SLYTNAKGSTISAFDGGSDSSSESEPEEPQSRKKLRMEAS
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgagcgataacgatgacatcgaggtggagagcgacgaagagcaaccgaggtttcaatct
gcggctgacaaacgggctcatcataatgcactggaacgaaaacgtagggaccacatcaaa
gacagctttcacagtttgcgggactcagtcccatcactccaaggagagaaggcatcccgg
gcccaaatcctagacaaagccacagaatatatccagtatatgcgaaggaaaaaccacaca
caccagcaagatattgacgacctcaagcggcagaatgctcttctggagcagcaagtccgt
gcactggagaaggcgaggtcaagtgcccaactgcagaccaactacccctcctcagacaac
agcctctacaccaacgccaagggcagcaccatctctgccttcgatgggggctcggactcc
agctcggagtctgagcctgaagagccccaaagcaggaagaagctccggatggaggccagc
taa

DBGET integrated database retrieval system