KEGG   Homo sapiens (human): 4150
Entry
4150              CDS       T01001                                 
Symbol
MAZ, PUR1, Pur-1, SAF-1, SAF-2, SAF-3, ZF87, ZNF801, Zif87
Name
(RefSeq) MYC associated zinc finger protein
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2_4 zf-C2H2 zf-C2H2_6 zf-C2H2_jaz zf-WRNIP1_ubi zf-Di19 zf-met DZR Zn-ribbon_8 FYVE GAGA UBZ_FAAP20 Rad50_zn_hook
Other DBs
NCBI-GeneID: 4150
NCBI-ProteinID: NP_002374
OMIM: 600999
HGNC: 6914
Ensembl: ENSG00000103495
Pharos: P56270(Tbio)
UniProt: P56270
Position
16:29806124..29811164
AA seq 477 aa
MFPVFPCTLLAPPFPVLGLDSRGVGGLMNSFPPPQGHAQNPLQVGAELQSRFFASQGCAQ
SPFQAAPAPPPTPQAPAAEPLQVDLLPVLAAAQESAAAAAAAAAAAAAVAAAPPAPAAAS
TVDTAALKQPPAPPPPPPPVSAPAAEAAPPASAATIAAAAATAVVAPTSTVAVAPVASAL
EKKTKSKGPYICALCAKEFKNGYNLRRHEAIHTGAKAGRVPSGAMKMPTMVPLSLLSVPQ
LSGAGGGGGEAGAGGGAAAVAAGGVVTTTASGKRIRKNHACEMCGKAFRDVYHLNRHKLS
HSDEKPYQCPVCQQRFKRKDRMSYHVRSHDGAVHKPYNCSHCGKSFSRPDHLNSHVRQVH
STERPFKCEKCEAAFATKDRLRAHTVRHEEKVPCHVCGKMLSSAYISDHMKVHSQGPHHV
CELCNKGTGEVCPMAAAAAAAAAAAAAAVAAPPTAVGSLSGAEGVPVSSQPLPSQPW
NT seq 1434 nt   +upstreamnt  +downstreamnt
atgttcccggtgtttccttgcacgctgctggccccccccttccccgtgctgggcctggac
tcccggggggtgggcggcctcatgaactccttcccgccacctcagggtcacgcccagaac
cccctgcaggtcggggctgagctccagtcccgcttctttgcctcccagggctgcgcccag
agtccattccaggccgcgccggcgcccccgcccacgccccaggccccggcggccgagccc
ctccaggtggacttgctcccggtgctcgccgccgcccaggagtccgccgcggctgctgcg
gccgctgccgccgctgctgccgccgtcgctgccgcgcccccggcccctgccgccgcctct
acggtggacacagcggccctgaagcagcctccggcgccccctccgccacccccgccagtg
tcggcgcccgcggccgaggccgcgccccccgcctccgccgccactatcgccgcggcggcg
gccaccgccgtcgtagccccaacctcgacggtcgccgtggccccggtcgcgtctgccttg
gagaagaagacaaagagcaaggggccctacatctgcgctctgtgcgccaaggagttcaag
aacggctacaatctccggaggcacgaagccatccacacgggagccaaggccggccgggtc
ccctcgggtgctatgaagatgccgaccatggtgcccctgagcctcctgagcgtgccccag
ctgagcggagccggcgggggagggggagaggcgggtgccggcggcggcgctgccgcagtg
gccgccggtggcgtggtgaccacgaccgcctcggggaagcgcatccggaagaaccatgcc
tgcgagatgtgtggcaaggccttccgcgacgtctaccacctgaaccgacacaagctgtcg
cactcggacgagaagccctaccagtgcccggtgtgccagcagcgcttcaagcgcaaggac
cgcatgagctaccacgtgcgctcacatgacggcgctgtgcacaagccctacaactgctcc
cactgtggcaagagcttctcccggccggatcacctcaacagtcacgtcagacaagtgcac
tcaacagaacggcccttcaaatgtgagaaatgtgaggcagctttcgccacgaaggatcgg
ctgcgggcgcacacagtacgacacgaggagaaagtgccatgtcacgtgtgtggcaagatg
ctgagctcggcttatatttcggaccacatgaaggtgcacagccagggtcctcaccatgtc
tgtgagctctgcaacaaaggtactggtgaggtttgtccaatggcggcggcagcggcagcg
gcggcagcggcagcagcggcagcagtagcagcccctcccacagctgtgggctccctctcg
ggggcggagggggtgcctgtgagctctcagccacttccctcccaaccctggtga

DBGET integrated database retrieval system