KEGG   Homo sapiens (human): 4151Help
Entry
4151              CDS       T01001                                 

Gene name
MB, PVALB, myoglobgin
Definition
(RefSeq) myoglobin
  KO
K21892  myoglobin
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    4151 (MB)
Transporters [BR:hsa02000]
 Other Transporters
  Pores ion channels [TC:1]
   4151 (MB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Globin LpxI_N
Motif
Other DBs
NCBI-GeneID: 4151
NCBI-ProteinID: NP_005359
OMIM: 160000
HGNC: 6915
Ensembl: ENSG00000198125
Vega: OTTHUMG00000150606
Pharos: P02144(Tbio)
UniProt: P02144 A0A1K0FU49
Structure
PDB: 

Position
22q12.3
AA seq 154 aa AA seqDB search
MGLSDGEWQLVLNVWGKVEADIPGHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASE
DLKKHGATVLTALGGILKKKGHHEAEIKPLAQSHATKHKIPVKYLEFISECIIQVLQSKH
PGDFGADAQGAMNKALELFRKDMASNYKELGFQG
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atggggctcagcgacggggaatggcagttggtgctgaacgtctgggggaaggtggaggct
gacatcccaggccatgggcaggaagtcctcatcaggctctttaagggtcacccagagact
ctggagaagtttgacaagttcaagcacctgaagtcagaggacgagatgaaggcgtctgag
gacttaaagaagcatggtgccaccgtgctcaccgccctgggtggcatccttaagaagaag
gggcatcatgaggcagagattaagcccctggcacagtcgcatgccaccaagcacaagatc
cccgtgaagtacctggagttcatctcggaatgcatcatccaggttctgcagagcaagcat
cccggggactttggtgctgatgcccagggggccatgaacaaggccctggagctgttccgg
aaggacatggcctccaactacaaggagctgggcttccagggctag

DBGET integrated database retrieval system