KEGG   Homo sapiens (human): 415116Help
Entry
415116            CDS       T01001                                 

Gene name
PIM3, pim-3
Definition
(RefSeq) Pim-3 proto-oncogene, serine/threonine kinase
  KO
K08807  proto-oncogene serine/threonine-protein kinase Pim-3 [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    415116 (PIM3)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     415116 (PIM3)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: CAMK group
  PIM family [OT]
   415116 (PIM3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Kdo APH FTA2
Motif
Other DBs
NCBI-GeneID: 415116
NCBI-ProteinID: NP_001001852
OMIM: 610580
HGNC: 19310
Ensembl: ENSG00000198355
Vega: OTTHUMG00000150290
Pharos: Q86V86(Tchem)
UniProt: Q86V86
Position
22q13.33
AA seq 326 aa AA seqDB search
MLLSKFGSLAHLCGPGGVDHLPVKILQPAKADKESFEKAYQVGAVLGSGGFGTVYAGSRI
ADGLPVAVKHVVKERVTEWGSLGGATVPLEVVLLRKVGAAGGARGVIRLLDWFERPDGFL
LVLERPEPAQDLFDFITERGALDEPLARRFFAQVLAAVRHCHSCGVVHRDIKDENLLVDL
RSGELKLIDFGSGALLKDTVYTDFDGTRVYSPPEWIRYHRYHGRSATVWSLGVLLYDMVC
GDIPFEQDEEILRGRLLFRRRVSPECQQLIRWCLSLRPSERPSLDQIAAHPWMLGADGGV
PESCDLRLCTLDPDDVASTTSSSESL
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgctgctctccaagttcggctccctggcgcacctctgcgggcccggcggcgtggaccac
ctcccggtgaagatcctgcagccagccaaggcggacaaggagagcttcgagaaggcgtac
caggtgggcgccgtgctgggtagcggcggcttcggcacggtctacgcgggtagccgcatc
gccgacgggctcccggtggctgtgaagcacgtggtgaaggagcgggtgaccgagtggggc
agcctgggcggcgcgaccgtgcccctggaggtggtgctgctgcgcaaggtgggcgcggcg
ggcggcgcgcgcggcgtcatccgcctgctggactggttcgagcggcccgacggcttcctg
ctggtgctggagcggcccgagccggcgcaggacctcttcgactttatcacggagcgcggc
gccctggacgagccgctggcgcgccgcttcttcgcgcaggtgctggccgccgtgcgccac
tgccacagctgcggggtcgtgcaccgcgacattaaggacgaaaatctgcttgtggacctg
cgctccggagagctcaagctcatcgacttcggttcgggtgcgctgctcaaggacacggtc
tacaccgacttcgacggcacccgagtgtacagccccccggagtggatccgctaccaccgc
taccacgggcgctcggccaccgtgtggtcgctgggcgtgcttctctacgatatggtgtgt
ggggacatccccttcgagcaggacgaggagatcctccgaggccgcctgctcttccggagg
agggtctctccagagtgccagcagctgatccggtggtgcctgtccctgcggccctcagag
cggccgtcgctggatcagattgcggcccatccctggatgctgggggctgacgggggcgtc
ccggagagctgtgacctgcggctgtgcaccctcgaccctgatgacgtggccagcaccacg
tccagcagcgagagcttgtga

DBGET integrated database retrieval system