KEGG   Homo sapiens (human): 4152Help
Entry
4152              CDS       T01001                                 

Gene name
MBD1, CXXC3, PCM1, RFT
Definition
(RefSeq) methyl-CpG binding domain protein 1
  KO
K11589  methyl-CpG-binding domain protein 1
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    4152 (MBD1)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Heterochromatin formation proteins
   MBPs (metylated DNA binding proteins)
    4152 (MBD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-CXXC MBD
Motif
Other DBs
NCBI-GeneID: 4152
NCBI-ProteinID: NP_001191068
OMIM: 156535
HGNC: 6916
Ensembl: ENSG00000141644
Vega: OTTHUMG00000132669
Pharos: Q9UIS9(Tbio)
UniProt: Q9UIS9 A8K654
Structure
PDB: 

Position
18q21.1
AA seq 605 aa AA seqDB search
MAEDWLDCPALGPGWKRREVFRKSGATCGRSDTYYQSPTGDRIRSKVELTRYLGPACDLT
LFDFKQGILCYPAPKAHPVAVASKKRKKPSRPAKTRKRQVGPQSGEVRKEAPRDETKADT
DTAPASFPAPGCCENCGISFSGDGTQRQRLKTLCKDCRAQRIAFNREQRMFKRVGCGECA
ACQVTEDCGACSTCLLQLPHDVASGLFCKCERRRCLRIVERSRGCGVCRGCQTQEDCGHC
PICLRPPRPGLRRQWKCVQRRCLRGKHARRKGGCDSKMAARRRPGAQPLPPPPPSQSPEP
TEPHPRALAPSPPAEFIYYCVDEDELQPYTNRRQNRKCGACAACLRRMDCGRCDFCCDKP
KFGGSNQKRQKCRWRQCLQFAMKRLLPSVWSESEDGAGSPPPYRRRKRPSSARRHHLGPT
LKPTLATRTAQPDHTQAPTKQEAGGGFVLPPPGTDLVFLREGASSPVQVPGPVAASTEAL
LQEAQCSGLSWVVALPQVKQEKADTQDEWTPGTAVLTSPVLVPGCPSKAVDPGLPSVKQE
PPDPEEDKEENKDDSASKLAPEEEAGGAGTPVITEIFSLGGTRFRDTAVWLPRSKDLKKP
GARKQ
NT seq 1818 nt NT seq  +upstreamnt  +downstreamnt
atggctgaggactggctggactgcccggccctgggccctggctggaagcgccgcgaagtc
tttcgcaagtcaggggccacctgtggacgctcagacacctattaccagagccccacagga
gacaggatccgaagcaaagttgagctgactcgatacctgggccctgcgtgtgatctcacc
ctcttcgacttcaaacaaggcatcttgtgctatccagcccccaaggcccatcccgtggcg
gttgccagcaagaagcgaaagaagccttcaaggccagccaagactcggaaacgtcaggtt
ggaccccagagtggtgaggtcaggaaggaggccccgagggatgagaccaaggctgacact
gacacagccccagcttcattccctgctcctgggtgctgtgagaactgtggaatcagcttc
tcaggggatggcacccaaaggcagcggctcaaaacgttgtgcaaagactgtcgagcacag
agaattgccttcaaccgggaacagagaatgtttaagcgtgtgggctgtggggagtgtgca
gcctgccaggtaacagaagactgtggggcctgctccacctgcctcctgcagctgccccat
gatgtggcatcggggctgttctgcaagtgtgaacggagacgctgcctccggattgtggaa
aggagccgagggtgtggagtatgccggggctgtcagacccaagaggattgtggccattgc
cccatctgccttcgccctccccgccctggtctcaggcgccagtggaaatgtgtccagcga
cgttgcctacggggtaaacatgcccgccgcaagggaggctgtgactccaagatggctgcc
aggcggcgccccggagcccagccactgcctccaccacccccatcacagtccccagagccc
acagagccgcaccccagagccctggccccctcgccacctgccgagttcatctattactgt
gtagacgaggacgagctacagccctacacgaaccgccggcagaaccgcaagtgcggggcc
tgtgcagcctgcctacggcggatggactgtggccgctgcgacttctgctgcgacaagccc
aaattcgggggcagcaaccagaagcgccagaagtgtcgttggcgccaatgcctgcagttt
gccatgaagcggctgctgcccagtgtctggtcagagtctgaggatggggcaggatcgccc
ccaccttaccgtcgtcgaaagaggcccagctctgcccgacggcaccatcttggccctacc
ttgaagcccaccttggctacacgcacagcccaaccagaccatacccaggctccaacgaag
caggaagcaggtggtggctttgtgctgcccccgcctggcactgaccttgtgtttttacgg
gaaggcgcaagcagtcctgtgcaggtgccgggccctgttgcagcttccacagaagccctg
ttgcaggaggcccagtgctctggcctgagttgggttgtggccttaccccaggtgaagcaa
gagaaggcggatacccaggacgagtggacaccaggcacagctgtcctgacttctcccgta
ttggtgcctggctgccctagcaaggcagtagacccaggcctgccttctgtgaagcaagag
ccacctgacccagaggaggacaaggaggagaacaaggatgattctgcctccaaattggcc
ccagaggaagaggcaggaggggctggcacacccgtgatcacggagattttcagcctgggt
ggaacccgcttccgagatacagcagtctggttgccaaggtccaaagaccttaaaaaacct
ggagctagaaagcagtag

DBGET integrated database retrieval system