KEGG   Homo sapiens (human): 4157Help
Entry
4157              CDS       T01001                                 

Gene name
MC1R, CMM5, MSH-R, SHEP2
Definition
(RefSeq) melanocortin 1 receptor
  KO
K04199  melanocortin 1 receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04916  Melanogenesis
Disease
H00168  Oculocutaneous albinism
Drug target
Giractide (DG01344): D09801 D09937
Seractide acetate: D05827
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    4157 (MC1R)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    4157 (MC1R)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    4157 (MC1R)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Peptide
   Melanocortin
    4157 (MC1R)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7tm_4 7TM_GPCR_Srsx 7TM_GPCR_Srx Pox_A14
Motif
Other DBs
NCBI-GeneID: 4157
NCBI-ProteinID: NP_002377
OMIM: 155555
HGNC: 6929
Ensembl: ENSG00000258839
Vega: OTTHUMG00000171163
Pharos: Q01726(Tclin)
UniProt: Q01726 Q1JUL4
Position
16q24.3
AA seq 317 aa AA seqDB search
MAVQGSQRRLLGSLNSTPTAIPQLGLAANQTGARCLEVSISDGLFLSLGLVSLVENALVV
ATIAKNRNLHSPMYCFICCLALSDLLVSGSNVLETAVILLLEAGALVARAAVLQQLDNVI
DVITCSSMLSSLCFLGAIAVDRYISIFYALRYHSIVTLPRARRAVAAIWVASVVFSTLFI
AYYDHVAVLLCLVVFFLAMLVLMAVLYVHMLARACQHAQGIARLHKRQRPVHQGFGLKGA
VTLTILLGIFFLCWGPFFLHLTLIVLCPEHPTCGCIFKNFNLFLALIICNAIIDPLIYAF
HSQELRRTLKEVLTCSW
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atggctgtgcagggatcccagagaagacttctgggctccctcaactccacccccacagcc
atcccccagctggggctggctgccaaccagacaggagcccggtgcctggaggtgtccatc
tctgacgggctcttcctcagcctggggctggtgagcttggtggagaacgcgctggtggtg
gccaccatcgccaagaaccggaacctgcactcacccatgtactgcttcatctgctgcctg
gccttgtcggacctgctggtgagcgggagcaacgtgctggagacggccgtcatcctcctg
ctggaggccggtgcactggtggcccgggctgcggtgctgcagcagctggacaatgtcatt
gacgtgatcacctgcagctccatgctgtccagcctctgcttcctgggcgccatcgccgtg
gaccgctacatctccatcttctacgcactgcgctaccacagcatcgtgaccctgccgcgg
gcgcggcgagccgttgcggccatctgggtggccagtgtcgtcttcagcacgctcttcatc
gcctactacgaccacgtggccgtcctgctgtgcctcgtggtcttcttcctggctatgctg
gtgctcatggccgtgctgtacgtccacatgctggcccgggcctgccagcacgcccagggc
atcgcccggctccacaagaggcagcgcccggtccaccagggctttggccttaaaggcgct
gtcaccctcaccatcctgctgggcattttcttcctctgctggggccccttcttcctgcat
ctcacactcatcgtcctctgccccgagcaccccacgtgcggctgcatcttcaagaacttc
aacctctttctcgccctcatcatctgcaatgccatcatcgaccccctcatctacgccttc
cacagccaggagctccgcaggacgctcaaggaggtgctgacatgctcctggtga

DBGET integrated database retrieval system