KEGG   Homo sapiens (human): 4159Help
Entry
4159              CDS       T01001                                 

Gene name
MC3R, BMIQ9, MC3, MC3-R, OB20, OQTL
Definition
(RefSeq) melanocortin 3 receptor
  KO
K04201  melanocortin 3 receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
Disease
H02106  Genetic obesity
Drug target
Giractide (DG01344): D09801 D09937
Seractide acetate: D05827
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    4159 (MC3R)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    4159 (MC3R)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Peptide
   Melanocortin
    4159 (MC3R)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7tm_4 7TM_GPCR_Srsx 7TM_GPCR_Srx
Motif
Other DBs
NCBI-GeneID: 4159
NCBI-ProteinID: NP_063941
OMIM: 155540
HGNC: 6931
Ensembl: ENSG00000124089
Vega: OTTHUMG00000032785
Pharos: P41968(Tchem)
UniProt: P41968
Position
20q13.2
AA seq 323 aa AA seqDB search
MNASCCLPSVQPTLPNGSEHLQAPFFSNQSSSAFCEQVFIKPEVFLSLGIVSLLENILVI
LAVVRNGNLHSPMYFFLCSLAVADMLVSVSNALETIMIAIVHSDYLTFEDQFIQHMDNIF
DSMICISLVASICNLLAIAVDRYVTIFYALRYHSIMTVRKALTLIVAIWVCCGVCGVVFI
VYSESKMVIVCLITMFFAMMLLMGTLYVHMFLFARLHVKRIAALPPADGVAPQQHSCMKG
AVTITILLGVFIFCWAPFFLHLVLIITCPTNPYCICYTAHFNTYLVLIMCNSVIDPLIYA
FRSLELRNTFREILCGCNGMNLG
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcttcgtgctgcctgccctctgttcagccaacactgcctaatggctcggagcac
ctccaagcccctttcttcagcaaccagagcagcagcgccttctgtgagcaggtcttcatc
aagcccgaggttttcctgtctctgggcatcgtcagtctgctggaaaacatcctggttatc
ctggccgtggtcaggaacggcaacctgcactccccgatgtacttctttctctgcagcctg
gcggtggccgacatgctggtaagtgtgtccaatgccctggagaccatcatgatcgccatc
gtccacagcgactacctgaccttcgaggaccagtttatccagcacatggacaacatcttc
gactccatgatctgcatctccctggtggcctccatctgcaacctcctggccatcgccgtc
gacaggtacgtcaccatcttttacgcgctccgctaccacagcatcatgaccgtgaggaag
gccctcaccttgatcgtggccatctgggtctgctgcggcgtctgtggcgtggtgttcatc
gtctactcggagagcaaaatggtcattgtgtgcctcatcaccatgttcttcgccatgatg
ctcctcatgggcaccctctacgtgcacatgttcctctttgcgcggctgcacgtcaagcgc
atagcagcactgccacctgccgacggggtggccccacagcaacactcatgcatgaagggg
gcagtcaccatcaccattctcctgggcgtgttcatcttctgctgggcccccttcttcctc
cacctggtcctcatcatcacctgccccaccaacccctactgcatctgctacactgcccac
ttcaacacctacctggtcctcatcatgtgcaactccgtcatcgacccactcatctacgct
ttccggagcctggaattgcgcaacacctttagggagattctctgtggctgcaacggcatg
aacttgggatag

DBGET integrated database retrieval system