KEGG   Homo sapiens (human): 416
Entry
416               CDS       T01001                                 
Symbol
ARSF, ASF
Name
(RefSeq) arylsulfatase F
  KO
K12374  arylsulfatase D/F/H [EC:3.1.6.-]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    416 (ARSF)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.6  Sulfuric-ester hydrolases
    3.1.6.-
     416 (ARSF)
SSDB
Motif
Pfam: Sulfatase Sulfatase_C Phosphodiest DUF229 Metalloenzyme
Other DBs
NCBI-GeneID: 416
NCBI-ProteinID: NP_001188467
OMIM: 300003
HGNC: 721
Ensembl: ENSG00000062096
Pharos: P54793(Tbio)
UniProt: P54793
Position
X:3040234..3112727
AA seq 590 aa
MRPRRPLVFMSLVCALLNTCQAHRVHDDKPNIVLIMVDDLGIGDLGCYGNDTMRTPHIDR
LAREGVRLTQHISAASLCSPSRSAFLTGRYPIRSGMVSSGNRRVIQNLAVPAGLPLNETT
LAALLKKQGYSTGLIGKWHQGLNCDSRSDQCHHPYNYGFDYYYGMPFTLVDSCWPDPSRN
TELAFESQLWLCVQLVAIAILTLTFGKLSGWVSVPWLLIFSMILFIFLLGYAWFSSHTSP
LYWDCLLMRGHEITEQPMKAERAGSIMVKEAISFLERHSKETFLLFFSFLHVHTPLPTTD
DFTGTSKHGLYGDNVEEMDSMVGKILDAIDDFGLRNNTLVYFTSDHGGHLEARRGHAQLG
GWNGIYKGGKGMGGWEGGIRVPGIVRWPGKVPAGRLIKEPTSLMDILPTVASVSGGSLPQ
DRVIDGRDLMPLLQGNVRHSEHEFLFHYCGSYLHAVRWIPKDDSGSVWKAHYVTPVFQPP
ASGGCYVTSLCRCFGEQVTYHNPPLLFDLSRDPSESTPLTPATEPLHDFVIKKVANALKE
HQETIVPVTYQLSELNQGRTWLKPCCGVFPFCLCDKEEEVSQPRGPNEKR
NT seq 1773 nt   +upstreamnt  +downstreamnt
atgaggcccaggagacccttggtcttcatgtctttggtgtgtgcactcttgaacacatgc
caggcacacagggtgcatgacgacaagcctaatattgtcctaatcatggttgatgacctg
ggtattggagatctgggctgctacggcaatgacaccatgaggacgcctcacatcgaccgc
cttgccagggaaggcgtgcgactgactcagcacatctctgccgcctccctctgcagccca
agccggtccgcgttcttgacgggaagataccccatccgatcaggtatggtttctagtggt
aatagacgtgtcatccaaaatcttgcagtccccgcaggcctccctcttaatgagacaaca
cttgcagccttgctaaagaagcaaggatacagcacggggcttataggcaaatggcaccaa
ggcttgaactgcgactcccgaagtgaccagtgccaccatccatataattatgggtttgac
tactactatggcatgccgttcactctcgttgacagctgctggccggacccctctcgtaac
acggaattagcctttgagagtcagctctggctctgtgtgcagctagttgccattgccatc
ctcaccctaacctttgggaagctgagcggctgggtctctgttccctggctcctgatcttc
tccatgattctgtttattttcctcttgggctatgcttggttctccagccacacgtcccct
ttatactgggactgcctcctcatgcgggggcacgagatcacggagcagcccatgaaggct
gaacgagctggatccattatggtgaaggaagcgatttcctttttagaaaggcacagtaag
gaaactttccttctctttttctcctttcttcacgtgcacacacctctccccaccacggac
gatttcactggcaccagcaagcatggcttgtatggggataatgtggaagagatggactcc
atggtgggcaagattcttgatgctatcgatgattttggcctaaggaacaacacccttgtc
tactttacatcagatcacggagggcatttggaagctaggcgagggcatgcccaacttggt
ggatggaatggaatatacaaaggtggaaaaggcatggggggctgggaaggtggaatccgc
gtcccaggaattgtccgatggcctggaaaggtaccagctggacggttgattaaggaacct
acaagtttaatggatattttaccaactgtcgcatcagtgtcaggaggaagtctccctcag
gacagggtcattgacggccgagacctcatgcccttgctgcagggcaacgtcaggcactcg
gagcatgaatttcttttccactactgtggctcctacctgcacgccgtgcggtggatcccc
aaggacgacagtgggtcagtttggaaggctcactatgtgaccccggtattccagccacca
gcttctggtggctgctatgtcacctcattatgcagatgtttcggagaacaggttacctac
cacaacccccctctgctcttcgatctctccagggacccctcagagtccacacccctgaca
cctgccacagagcccctccatgattttgtgattaaaaaggtggccaacgccctgaaggaa
caccaggaaaccatcgtgcctgtgacctaccaactctcagaactgaatcagggcaggacg
tggctgaagccttgctgtggggtgttcccattttgtctgtgtgacaaggaagaggaagtc
tctcagcctcggggtcctaacgagaagagataa

DBGET integrated database retrieval system