KEGG   Homo sapiens (human): 4161Help
Entry
4161              CDS       T01001                                 

Gene name
MC5R, MC2
Definition
(RefSeq) melanocortin 5 receptor
  KO
K04203  melanocortin 5 receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
Drug target
Giractide (DG01344): D09801 D09937
Seractide acetate: D05827
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    4161 (MC5R)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    4161 (MC5R)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Peptide
   Melanocortin
    4161 (MC5R)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7tm_4 7TM_GPCR_Srsx 7TM_GPCR_Srx
Motif
Other DBs
NCBI-GeneID: 4161
NCBI-ProteinID: NP_005904
OMIM: 600042
HGNC: 6933
Ensembl: ENSG00000176136
Vega: OTTHUMG00000131720
Pharos: P33032(Tchem)
UniProt: P33032 K7ER30
Position
18p11.21
AA seq 325 aa AA seqDB search
MNSSFHLHFLDLNLNATEGNLSGPNVKNKSSPCEDMGIAVEVFLTLGVISLLENILVIGA
IVKNKNLHSPMYFFVCSLAVADMLVSMSSAWETITIYLLNNKHLVIADAFVRHIDNVFDS
MICISVVASMCSLLAIAVDRYVTIFYALRYHHIMTARRSGAIIAGIWAFCTGCGIVFILY
SESTYVILCLISMFFAMLFLLVSLYIHMFLLARTHVKRIAALPGASSARQRTSMQGAVTV
TMLLGVFTVCWAPFFLHLTLMLSCPQNLYCSRFMSHFNMYLILIMCNSVMDPLIYAFRSQ
EMRKTFKEIICCRGFRIACSFPRRD
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgaattcctcatttcacctgcatttcttggatctcaacctgaatgccacagagggcaac
ctttcaggacccaatgtcaaaaacaagtcttcaccatgtgaagacatgggcattgctgtg
gaggtgtttctcactctgggtgtcatcagcctcttggagaacatcttggtcataggggcc
atagtgaagaacaaaaacctgcactcccccatgtacttcttcgtgtgcagcctggcagtg
gcggacatgctggtgagcatgtccagtgcctgggagaccatcaccatctacctactcaac
aacaagcacctagtgatagcagacgcctttgtgcgccacattgacaatgtgtttgactcc
atgatctgcatttccgtggtggcatccatgtgcagcttactggccattgcagtggatagg
tacgtcaccatcttctacgccctgcgctaccaccacatcatgacggcgaggcgctcaggg
gccatcatcgccggcatctgggctttctgcacgggctgcggcattgtcttcatcctgtac
tcagaatccacctacgtcatcctgtgcctcatctccatgttcttcgctatgctgttcctc
ctggtgtctctgtacatacacatgttcctcctggcgcggactcacgtcaagcggatcgcg
gctctgcccggggccagctctgcgcggcagaggaccagcatgcagggcgcggtcaccgtc
accatgctgctgggcgtgtttaccgtgtgctgggccccgttcttccttcatctcacttta
atgctttcttgccctcagaacctctactgctctcgcttcatgtctcacttcaatatgtac
ctcatactcatcatgtgtaattccgtgatggaccctctcatatatgccttccgcagccaa
gagatgcggaagacctttaaggagattatttgctgccgtggtttcaggatcgcctgcagc
tttcccagaagggattaa

DBGET integrated database retrieval system