KEGG   Homo sapiens (human): 4162
Entry
4162              CDS       T01001                                 
Symbol
MCAM, CD146, HEMCAM, METCAM, MUC18, MelCAM
Name
(RefSeq) melanoma cell adhesion molecule
  KO
K06534  melanoma cell adhesion molecule
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    4162 (MCAM)
   04515 Cell adhesion molecules [BR:hsa04515]
    4162 (MCAM)
   04090 CD molecules [BR:hsa04090]
    4162 (MCAM)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of melanoma cells
   4162 (MCAM)
Cell adhesion molecules [BR:hsa04515]
 Immunoglobulin superfamily
  MCAM
   4162 (MCAM)
CD molecules [BR:hsa04090]
 Proteins
  4162 (MCAM)
SSDB
Motif
Pfam: Ig_3 ig Ig_2 C2-set_2 I-set V-set Insulin_TMD DUF4198 Orf78 Mucin
Other DBs
NCBI-GeneID: 4162
NCBI-ProteinID: NP_006491
OMIM: 155735
HGNC: 6934
Ensembl: ENSG00000076706
Pharos: P43121(Tbio)
UniProt: P43121 A0A024R3I5
Structure
Position
11:complement(119308529..119317130)
AA seq 646 aa
MGLPRLVCAFLLAACCCCPRVAGVPGEAEQPAPELVEVEVGSTALLKCGLSQSQGNLSHV
DWFSVHKEKRTLIFRVRQGQGQSEPGEYEQRLSLQDRGATLALTQVTPQDERIFLCQGKR
PRSQEYRIQLRVYKAPEEPNIQVNPLGIPVNSKEPEEVATCVGRNGYPIPQVIWYKNGRP
LKEEKNRVHIQSSQTVESSGLYTLQSILKAQLVKEDKDAQFYCELNYRLPSGNHMKESRE
VTVPVFYPTEKVWLEVEPVGMLKEGDRVEIRCLADGNPPPHFSISKQNPSTREAEEETTN
DNGVLVLEPARKEHSGRYECQGLDLDTMISLLSEPQELLVNYVSDVRVSPAAPERQEGSS
LTLTCEAESSQDLEFQWLREETGQVLERGPVLQLHDLKREAGGGYRCVASVPSIPGLNRT
QLVNVAIFGPPWMAFKERKVWVKENMVLNLSCEASGHPRPTISWNVNGTASEQDQDPQRV
LSTLNVLVTPELLETGVECTASNDLGKNTSILFLELVNLTTLTPDSNTTTGLSTSTASPH
TRANSTSTERKLPEPESRGVVIVAVIVCILVLAVLGAVLYFLYKKGKLPCRRSGKQEITL
PPSRKSELVVEVKSDKLPEEMGLLQGSSGDKRAPGDQGEKYIDLRH
NT seq 1941 nt   +upstreamnt  +downstreamnt
atggggcttcccaggctggtctgcgccttcttgctcgccgcctgctgctgctgtcctcgc
gtcgcgggtgtgcccggagaggctgagcagcctgcgcctgagctggtggaggtggaagtg
ggcagcacagcccttctgaagtgcggcctctcccagtcccaaggcaacctcagccatgtc
gactggttttctgtccacaaggagaagcggacgctcatcttccgtgtgcgccagggccag
ggccagagcgaacctggggagtacgagcagcggctcagcctccaggacagaggggctact
ctggccctgactcaagtcaccccccaagacgagcgcatcttcttgtgccagggcaagcgc
cctcggtcccaggagtaccgcatccagctccgcgtctacaaagctccggaggagccaaac
atccaggtcaaccccctgggcatccctgtgaacagtaaggagcctgaggaggtcgctacc
tgtgtagggaggaacgggtaccccattcctcaagtcatctggtacaagaatggccggcct
ctgaaggaggagaagaaccgggtccacattcagtcgtcccagactgtggagtcgagtggt
ttgtacaccttgcagagtattctgaaggcacagctggttaaagaagacaaagatgcccag
ttttactgtgagctcaactaccggctgcccagtgggaaccacatgaaggagtccagggaa
gtcaccgtccctgttttctacccgacagaaaaagtgtggctggaagtggagcccgtggga
atgctgaaggaaggggaccgcgtggaaatcaggtgtttggctgatggcaaccctccacca
cacttcagcatcagcaagcagaaccccagcaccagggaggcagaggaagagacaaccaac
gacaacggggtcctggtgctggagcctgcccggaaggaacacagtgggcgctatgaatgt
cagggcctggacttggacaccatgatatcgctgctgagtgaaccacaggaactactggtg
aactatgtgtctgacgtccgagtgagtcccgcagcccctgagagacaggaaggcagcagc
ctcaccctgacctgtgaggcagagagtagccaggacctcgagttccagtggctgagagaa
gagacaggccaggtgctggaaagggggcctgtgcttcagttgcatgacctgaaacgggag
gcaggaggcggctatcgctgcgtggcgtctgtgcccagcatacccggcctgaaccgcaca
cagctggtcaacgtggccatttttggccccccttggatggcattcaaggagaggaaggtg
tgggtgaaagagaatatggtgttgaatctgtcttgtgaagcgtcagggcacccccggccc
accatctcctggaacgtcaacggcacggcaagtgaacaagaccaagatccacagcgagtc
ctgagcaccctgaatgtcctcgtgaccccggagctgttggagacaggtgttgaatgcacg
gcctccaacgacctgggcaaaaacaccagcatcctcttcctggagctggtcaatttaacc
accctcacaccagactccaacacaaccactggcctcagcacttccactgccagtcctcat
accagagccaacagcacctccacagagagaaagctgccggagccggagagccggggcgtg
gtcatcgtggctgtgattgtgtgcatcctggtcctggcggtgctgggcgctgtcctctat
ttcctctataagaagggcaagctgccgtgcaggcgctcagggaagcaggagatcacgcta
cccccgtctcgtaagagcgaacttgtagttgaagttaagtcagataagctcccagaagag
atgggcctcctgcagggcagcagcggtgacaagagggctccgggagaccagggagagaaa
tacatcgatctgaggcattag

DBGET integrated database retrieval system