KEGG   Homo sapiens (human): 4171Help
Entry
4171              CDS       T01001                                 

Gene name
MCM2, BM28, CCNL1, CDCL1, D3S3194, DFNA70, MITOTIN, cdc19
Definition
(RefSeq) minichromosome maintenance complex component 2
  KO
K02540  DNA replication licensing factor MCM2 [EC:3.6.4.12]
Organism
hsa  Homo sapiens (human)
Pathway
hsa03030  DNA replication
hsa04110  Cell cycle
Disease
H00604  Deafness, autosomal dominant
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    4171 (MCM2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    4171 (MCM2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:hsa03032]
    4171 (MCM2)
   03036 Chromosome and associated proteins [BR:hsa03036]
    4171 (MCM2)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     4171 (MCM2)
DNA replication proteins [BR:hsa03032]
 Eukaryotic Type
  DNA Replication Initiation Factors
   pre-RC (pre-replication complex)
    4171 (MCM2)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    4171 (MCM2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MCM MCM_OB MCM_lid MCM2_N MCM_N Mg_chelatase AAA_3 AAA_5 AAA_lid_2 DUF445 AAA AAA_2 Sigma54_activ_2
Motif
Other DBs
NCBI-GeneID: 4171
NCBI-ProteinID: NP_004517
OMIM: 116945
HGNC: 6944
Ensembl: ENSG00000073111
Vega: OTTHUMG00000159637
Pharos: P49736(Tbio)
UniProt: P49736
Structure
PDB: 

Position
3q21.3
AA seq 904 aa AA seqDB search
MAESSESFTMASSPAQRRRGNDPLTSSPGRSSRRTDALTSSPGRDLPPFEDESEGLLGTE
GPLEEEEDGEELIGDGMERDYRAIPELDAYEAEGLALDDEDVEELTASQREAAERAMRQR
DREAGRGLGRMRRGLLYDSDEEDEERPARKRRQVERATEDGEEDEEMIESIENLEDLKGH
SVREWVSMAGPRLEIHHRFKNFLRTHVDSHGHNVFKERISDMCKENRESLVVNYEDLAAR
EHVLAYFLPEAPAELLQIFDEAALEVVLAMYPKYDRITNHIHVRISHLPLVEELRSLRQL
HLNQLIRTSGVVTSCTGVLPQLSMVKYNCNKCNFVLGPFCQSQNQEVKPGSCPECQSAGP
FEVNMEETIYQNYQRIRIQESPGKVAAGRLPRSKDAILLADLVDSCKPGDEIELTGIYHN
NYDGSLNTANGFPVFATVILANHVAKKDNKVAVGELTDEDVKMITSLSKDQQIGEKIFAS
IAPSIYGHEDIKRGLALALFGGEPKNPGGKHKVRGDINVLLCGDPGTAKSQFLKYIEKVS
SRAIFTTGQGASAVGLTAYVQRHPVSREWTLEAGALVLADRGVCLIDEFDKMNDQDRTSI
HEAMEQQSISISKAGIVTSLQARCTVIAAANPIGGRYDPSLTFSENVDLTEPIISRFDIL
CVVRDTVDPVQDEMLARFVVGSHVRHHPSNKEEEGLANGSAAEPAMPNTYGVEPLPQEVL
KKYIIYAKERVHPKLNQMDQDKVAKMYSDLRKESMATGSIPITVRHIESMIRMAEAHARI
HLRDYVIEDDVNMAIRVMLESFIDTQKFSVMRSMRKTFARYLSFRRDNNELLLFILKQLV
AEQVTYQRNRFGAQQDTIEVPEKDLVDKARQINIHNLSAFYDSELFRMNKFSHDLKRKMI
LQQF
NT seq 2715 nt NT seq  +upstreamnt  +downstreamnt
atggcggaatcatcggaatccttcaccatggcatccagcccggcccagcgtcggcgaggc
aatgatcctctcacctccagccctggccgaagctcccggcgtactgatgccctcacctcc
agccctggccgtgaccttccaccatttgaggatgagtccgaggggctcctaggcacagag
gggcccctggaggaagaagaggatggagaggagctcattggagatggcatggaaagggac
taccgcgccatcccagagctggacgcctatgaggccgagggactggctctggatgatgag
gacgtagaggagctgacggccagtcagagggaggcagcagagcgggccatgcggcagcgt
gaccgggaggctggccggggcctgggccgcatgcgccgtgggctcctgtatgacagcgat
gaggaggacgaggagcgccctgcccgcaagcgccgccaggtggagcgggccacggaggac
ggcgaggaggacgaggagatgatcgagagcatcgagaacctggaggatctcaaaggccac
tctgtgcgcgagtgggtgagcatggcgggcccccggctggagatccaccaccgcttcaag
aacttcctgcgcactcacgtcgacagccacggccacaacgtcttcaaggagcgcatcagc
gacatgtgcaaagagaaccgtgagagcctggtggtgaactatgaggacttggcagccagg
gagcacgtgctggcctacttcctgcctgaggcaccggcggagctgctgcagatctttgat
gaggctgccctggaggtggtactggccatgtaccccaagtacgaccgcatcaccaaccac
atccatgtccgcatctcccacctgcctctggtggaggagctgcgctcgctgaggcagctg
catctgaaccagctgatccgcaccagtggggtggtgaccagctgcactggcgtcctgccc
cagctcagcatggtcaagtacaactgcaacaagtgcaatttcgtcctgggtcctttctgc
cagtcccagaaccaggaggtgaaaccaggctcctgtcctgagtgccagtcggccggcccc
tttgaggtcaacatggaggagaccatctatcagaactaccagcgtatccgaatccaggag
agtccaggcaaagtggcggctggccggctgccccgctccaaggacgccattctcctcgca
gatctggtggacagctgcaagccaggagacgagatagagctgactggcatctatcacaac
aactatgatggctccctcaacactgccaatggcttccctgtctttgccactgtcatccta
gccaaccacgtggccaagaaggacaacaaggttgctgtaggggaactgaccgatgaagat
gtgaagatgatcactagcctctccaaggatcagcagatcggagagaagatctttgccagc
attgctccttccatctatggtcatgaagacatcaagagaggcctggctctggccctgttc
ggaggggagcccaaaaacccaggtggcaagcacaaggtacgtggtgatatcaacgtgctc
ttgtgcggagaccctggcacagcgaagtcgcagtttctcaagtatattgagaaagtgtcc
agccgagccatcttcaccactggccagggggcgtcggctgtgggcctcacggcgtatgtc
cagcggcaccctgtcagcagggagtggaccttggaggctggggccctggttctggctgac
cgaggagtgtgtctcattgatgaatttgacaagatgaatgaccaggacagaaccagcatc
catgaggccatggagcaacagagcatctccatctcgaaggctggcatcgtcacctccctg
caggctcgctgcacggtcattgctgccgccaaccccataggagggcgctacgacccctcg
ctgactttctctgagaacgtggacctcacagagcccatcatctcacgctttgacatcctg
tgtgtggtgagggacaccgtggacccagtccaggacgagatgctggcccgcttcgtggtg
ggcagccacgtcagacaccaccccagcaacaaggaggaggaggggctggccaatggcagc
gctgctgagcccgccatgcccaacacgtatggcgtggagcccctgccccaggaggtcctg
aagaagtacatcatctacgccaaggagagggtccacccgaagctcaaccagatggaccag
gacaaggtggccaagatgtacagtgacctgaggaaagaatctatggcgacaggcagcatc
cccattacggtgcggcacatcgagtccatgatccgcatggcggaggcccacgcgcgcatc
catctgcgggactatgtgatcgaagacgacgtcaacatggccatccgcgtgatgctggag
agcttcatagacacacagaagttcagcgtcatgcgcagcatgcgcaagacttttgcccgc
tacctttcattccggcgtgacaacaatgagctgttgctcttcatactgaagcagttagtg
gcagagcaggtgacatatcagcgcaaccgctttggggcccagcaggacactattgaggtc
cctgagaaggacttggtggataaggctcgtcagatcaacatccacaacctctctgcattt
tatgacagtgagctcttcaggatgaacaagttcagccacgacctgaaaaggaaaatgatc
ctgcagcagttctga

DBGET integrated database retrieval system