KEGG   Homo sapiens (human): 4172Help
Entry
4172              CDS       T01001                                 

Gene name
MCM3, HCC5, P1-MCM3, P1.h, RLFB
Definition
(RefSeq) minichromosome maintenance complex component 3
  KO
K02541  DNA replication licensing factor MCM3 [EC:3.6.4.12]
Organism
hsa  Homo sapiens (human)
Pathway
hsa03030  DNA replication
hsa04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    4172 (MCM3)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    4172 (MCM3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:hsa03032]
    4172 (MCM3)
   03036 Chromosome and associated proteins [BR:hsa03036]
    4172 (MCM3)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     4172 (MCM3)
DNA replication proteins [BR:hsa03032]
 Eukaryotic Type
  DNA Replication Initiation Factors
   pre-RC (pre-replication complex)
    4172 (MCM3)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    4172 (MCM3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MCM MCM_OB MCM_lid MCM_N Mg_chelatase AAA_3 AAA_5 Sigma54_activat
Motif
Other DBs
NCBI-GeneID: 4172
NCBI-ProteinID: NP_002379
OMIM: 602693
HGNC: 6945
Ensembl: ENSG00000112118
Vega: OTTHUMG00000014844
Pharos: P25205(Tbio)
UniProt: P25205 A0A0S2Z4T1
Position
6p12.2
AA seq 808 aa AA seqDB search
MAGTVVLDDVELREAQRDYLDFLDDEEDQGIYQSKVRELISDNQYRLIVNVNDLRRKNEK
RANRLLNNAFEELVAFQRALKDFVASIDATYAKQYEEFYVGLEGSFGSKHVSPRTLTSCF
LSCVVCVEGIVTKCSLVRPKVVRSVHYCPATKKTIERRYSDLTTLVAFPSSSVYPTKDEE
NNPLETEYGLSVYKDHQTITIQEMPEKAPAGQLPRSVDVILDDDLVDKAKPGDRVQVVGT
YRCLPGKKGGYTSGTFRTVLIACNVKQMSKDAQPSFSAEDIAKIKKFSKTRSKDIFDQLA
KSLAPSIHGHDYVKKAILCLLLGGVERDLENGSHIRGDINILLIGDPSVAKSQLLRYVLC
TAPRAIPTTGRGSSGVGLTAAVTTDQETGERRLEAGAMVLADRGVVCIDEFDKMSDMDRT
AIHEVMEQGRVTIAKAGIHARLNARCSVLAAANPVYGRYDQYKTPMENIGLQDSLLSRFD
LLFIMLDQMDPEQDREISDHVLRMHRYRAPGEQDGDAMPLGSAVDILATDDPNFSQEDQQ
DTQIYEKHDNLLHGTKKKKEKMVSAAFMKKYIHVAKIIKPVLTQESATYIAEEYSRLRSQ
DSMSSDTARTSPVTARTLETLIRLATAHAKARMSKTVDLQDAEEAVELVQYAYFKKVLEK
EKKRKKRSEDESETEDEEEKSQEDQEQKRKRRKTRQPDAKDGDSYDPYDFSDTEEEMPQV
HTPKTADSQETKESQKVELSESRLKAFKVALLDVFREAHAQSIGMNRLTESINRDSEEPF
SSVEIQAALSKMQDDNQVMVSEGIIFLI
NT seq 2427 nt NT seq  +upstreamnt  +downstreamnt
atggcgggtaccgtggtgctggacgatgtggagctgcgggaggctcagagagattacctg
gacttcctggacgacgaggaagaccagggaatttatcagagcaaagttcgggagctgatc
agtgacaaccaataccggctgattgtcaatgtgaatgacctgcgcaggaaaaacgagaag
agggctaaccggcttctgaacaatgcctttgaggagctggttgccttccagcgggcctta
aaggattttgtggcctccattgatgctacctatgccaagcagtatgaggagttctacgta
ggactggaaggcagctttggctccaagcacgtctccccgcggactcttacctcctgcttc
ctcagctgtgtggtctgtgtggagggcattgtcactaaatgttctctagttcgtcccaaa
gtcgtccgcagtgtccactactgtcctgctactaagaagaccatagagcgacgttattct
gatctcaccaccctggtggcctttccctccagctctgtctatcctaccaaggatgaggag
aacaatccccttgagacagaatatggcctttctgtctacaaggatcaccagaccatcacc
atccaggagatgccggagaaggccccagccggccagctcccccgctctgtggacgtcatt
ctggatgatgacttggtggataaagcgaagcctggtgaccgggttcaggtggtgggaacc
taccgttgccttcctggaaagaagggaggctacacctctgggaccttcaggactgtcctg
attgcctgtaatgttaagcagatgagcaaggatgctcagccctctttctctgctgaggat
atagccaagatcaagaagttcagtaaaacccgatccaaggatatctttgaccagctggcc
aagtcattggccccaagtatccatgggcatgactatgtcaagaaagcaatcctctgcttg
ctcttgggaggggtggaacgagacctagaaaatggcagccacatccgtggggacatcaat
attcttctaataggagacccatccgttgccaagtctcagcttctgcggtatgtgctttgc
actgcaccccgagctatccccaccactggccggggctcctctggagtgggtctgacggct
gctgtcaccacagaccaggaaacaggagagcgccgtctggaagcaggggccatggtcctg
gctgaccgaggcgtggtttgcattgatgaatttgacaaaatgtctgacatggatcgcaca
gccatccatgaagtgatggagcagggtcgagtgaccattgccaaggctggcatccatgct
cggctgaatgcccgctgcagtgttttggcagctgccaaccctgtctacggcaggtatgac
cagtataagactccaatggagaacattgggctacaggactcactgctgtcacgatttgac
ttgctcttcatcatgctggatcagatggatcctgagcaggatcgggagatctcagaccat
gtccttcggatgcaccgttacagagcacctggggagcaggatggcgatgctatgcccttg
ggtagtgctgtggatatcctggccacagatgatcccaactttagccaggaagatcagcag
gacacccagatttatgagaagcatgacaaccttctacatgggaccaagaagaaaaaggag
aagatggtgagtgcagcattcatgaagaagtacatccatgtggccaaaatcatcaagcct
gtcctgacacaggagtcggccacctacattgcagaagagtattcacgcctgcgcagccag
gatagcatgagctcagacaccgccaggacatctccagttacagcccgaacactggaaact
ctgattcgactggccacagcccatgcgaaggcccgcatgagcaagactgtggacctgcag
gatgcagaggaagctgtggagttggtccagtatgcttactttaagaaggttctggagaag
gagaagaaacgtaagaagcgaagtgaggatgaatcagagacagaagatgaagaggagaaa
agccaagaggaccaggagcagaagaggaagagaaggaagactcgccagccagatgccaaa
gatggggattcatacgacccctatgacttcagtgacacagaggaggaaatgcctcaagta
cacactccaaagacggcagactcacaggagaccaaggaatcccagaaagtggagttgagt
gaatccaggttgaaggcattcaaggtggccctcttggatgtgttccgggaagctcatgcg
cagtcaatcggcatgaatcgcctcacagaatccatcaaccgggacagcgaagagcccttc
tcttcagttgagatccaggctgctctgagcaagatgcaggatgacaatcaggtcatggtg
tctgagggcatcatcttcctcatctga

DBGET integrated database retrieval system