KEGG   Homo sapiens (human): 4173
Entry
4173              CDS       T01001                                 

Symbol
MCM4, CDC21, CDC54, IMD54, NKCD, NKGCD, P1-CDC21, hCdc21
Name
(RefSeq) minichromosome maintenance complex component 4
  KO
K02212  DNA replication licensing factor MCM4 [EC:3.6.4.12]
Organism
hsa  Homo sapiens (human)
Pathway
hsa03030  DNA replication
hsa04110  Cell cycle
Disease
H00094  Immunodeficiency associated with DNA repair defects
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    4173 (MCM4)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    4173 (MCM4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:hsa03032]
    4173 (MCM4)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     4173 (MCM4)
DNA replication proteins [BR:hsa03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   pre-RC (pre-replication complex)
    4173 (MCM4)
SSDB
Motif
Pfam: MCM MCM_OB MCM_lid MCM_N Mg_chelatase AAA_5 AAA_3 AAA HypA Elf1
Other DBs
NCBI-GeneID: 4173
NCBI-ProteinID: NP_005905
OMIM: 602638
HGNC: 6947
Ensembl: ENSG00000104738
Vega: OTTHUMG00000164205
Pharos: P33991(Tbio)
UniProt: P33991 B4DLA6
Position
8q11.21
AA seq 863 aa
MSSPASTPSRRGSRRGRATPAQTPRSEDARSSPSQRRRGEDSTSTGELQPMPTSPGVDLQ
SPAAQDVLFSSPPQMHSSAIPLDFDVSSPLTYGTPSSRVEGTPRSGVRGTPVRQRPDLGS
AQKGLQVDLQSDGAAAEDIVASEQSLGQKLVIWGTDVNVAACKENFQRFLQRFIDPLAKE
EENVGIDITEPLYMQRLGEINVIGEPFLNVNCEHIKSFDKNLYRQLISYPQEVIPTFDMA
VNEIFFDRYPDSILEHQIQVRPFNALKTKNMRNLNPEDIDQLITISGMVIRTSQLIPEMQ
EAFFQCQVCAHTTRVEMDRGRIAEPSVCGRCHTTHSMALIHNRSLFSDKQMIKLQESPED
MPAGQTPHTVILFAHNDLVDKVQPGDRVNVTGIYRAVPIRVNPRVSNVKSVYKTHIDVIH
YRKTDAKRLHGLDEEAEQKLFSEKRVELLKELSRKPDIYERLASALAPSIYEHEDIKKGI
LLQLFGGTRKDFSHTGRGKFRAEINILLCGDPGTSKSQLLQYVYNLVPRGQYTSGKGSSA
VGLTAYVMKDPETRQLVLQTGALVLSDNGICCIDEFDKMNESTRSVLHEVMEQQTLSIAK
AGIICQLNARTSVLAAANPIESQWNPKKTTIENIQLPHTLLSRFDLIFLLLDPQDEAYDR
RLAHHLVALYYQSEEQAEEELLDMAVLKDYIAYAHSTIMPRLSEEASQALIEAYVDMRKI
GSSRGMVSAYPRQLESLIRLAEAHAKVRLSNKVEAIDVEEAKRLHREALKQSATDPRTGI
VDISILTTGMSATSRKRKEELAEALKKLILSKGKTPALKYQQLFEDIRGQSDIAITKDMF
EEALRALADDDFLTVTGKTVRLL
NT seq 2592 nt   +upstreamnt  +downstreamnt
atgtcgtccccggcgtcgaccccgagccgccgcggcagccggcgtggaagggccaccccc
gcccagacgcctcggagtgaggatgccaggtcatctccctctcagagacgtagaggcgag
gattccacctccacgggggagttgcagccgatgccaacctcgcctggagtggacctgcag
agccctgctgcgcaggacgtgctgttttccagccctccccaaatgcattcttcagctatc
cctcttgactttgatgttagttcaccactgacatacggcactcccagctctcgggtagag
ggaaccccaagaagtggtgttaggggcacacctgtgagacagaggcctgacctgggctct
gcacagaagggcctgcaagtggatctgcagtctgacggggcagcagcagaagatatagtg
gcaagtgagcagtctctaggccaaaaacttgtgatctggggaacagatgtaaatgtggca
gcatgcaaagaaaactttcagagatttcttcagcgttttattgaccctctggctaaagaa
gaagaaaatgttggcatagatattactgaacctctatacatgcaacgacttggggagatt
aatgttattggtgagccatttttaaatgtgaactgtgaacacatcaaatcatttgacaaa
aatttgtacagacaactcatctcttacccacaggaagttattccaacttttgacatggct
gtcaatgaaatcttctttgaccgttaccctgactcaatcttagaacatcagattcaagta
agaccattcaacgcattgaagactaagaatatgagaaacctgaatccagaagacattgac
cagctcatcaccatcagcggcatggtgatcaggacatcccagctgattcccgagatgcag
gaggccttcttccagtgccaagtgtgtgcccacacgacccgggtggagatggaccgcggc
cgcattgcagagcccagtgtgtgcgggcgctgccacaccacccacagcatggcactcatc
cacaaccgctccctcttctctgacaagcagatgatcaagcttcaggagtctccggaagac
atgcctgcagggcagacaccacacacagttatcctgtttgctcacaatgatctcgttgac
aaggtccagcctggggacagagtgaatgttacaggcatctatcgagctgtgcctattcga
gtcaatccaagagtgagtaatgtgaagtctgtctacaaaacccacattgatgtcattcat
tatcggaaaacggatgcaaaacgtctgcatggccttgatgaagaagcagaacagaaactt
ttttcagagaaacgtgtggaattgcttaaggaactttccaggaaaccagacatttatgag
aggcttgcttcagccttggctccaagcatttatgaacatgaagatataaagaagggaatt
ttgcttcagctctttggcgggacaaggaaggattttagtcacactggaaggggcaaattt
cgggctgagatcaacatcttgctgtgtggcgaccctggtaccagcaagtcccagctgctg
cagtacgtgtacaacctcgtccccaggggccagtacacgtctgggaagggctccagtgca
gttggcctcactgcgtacgtaatgaaagaccctgagacaaggcagctggtcctgcagaca
ggtgctcttgtcctgagtgacaacggcatctgctgtatcgatgagttcgacaagatgaat
gaaagtacaagatcggtattgcatgaagtcatggaacagcagactctgtccattgcaaag
gctgggatcatctgtcagctcaatgcgcgcacctctgtcctggcagcagcaaatcccatt
gagtctcagtggaatcctaaaaaaacaaccattgaaaacatccagctgcctcatacttta
ttatcaaggtttgatttgatcttcctcttgctggaccctcaggacgaagcctatgacagg
cgtctggctcaccacctggtcgcactgtactaccagagcgaggagcaggcagaggaggag
ctcctggacatggcggtgctaaaggactacattgcctacgcgcacagcaccatcatgccg
cggctaagtgaggaagccagccaggctctcatcgaggcttatgtagacatgaggaagatt
ggcagtagccggggaatggtttctgcataccctcgacagctagagtcattaatccgctta
gcagaagcccatgctaaagtaagattgtctaacaaagttgaagccattgatgtggaagag
gccaaacgcctccatcgggaagctctgaagcagtctgcaactgatccccggactggcatc
gtggacatatctattcttactacggggatgagtgccacctctcgtaaacggaaagaagaa
ttagctgaagcattgaaaaagcttattttatctaagggcaaaacaccagctctaaaatac
cagcaactttttgaagatattcggggacaatctgacatagcaattactaaagatatgttt
gaagaagcactgcgtgccctggcagatgatgatttcctgacagtgactgggaagaccgtg
cgcttgctctga

DBGET integrated database retrieval system