KEGG   Homo sapiens (human): 4174Help
Entry
4174              CDS       T01001                                 

Gene name
MCM5, CDC46, MGORS8, P1-CDC46
Definition
(RefSeq) minichromosome maintenance complex component 5
  KO
K02209  DNA replication licensing factor MCM5 [EC:3.6.4.12]
Organism
hsa  Homo sapiens (human)
Pathway
hsa03030  DNA replication
hsa04110  Cell cycle
Module
hsa_M00285  MCM complex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    4174 (MCM5)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    4174 (MCM5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:hsa03032]
    4174 (MCM5)
   03036 Chromosome and associated proteins [BR:hsa03036]
    4174 (MCM5)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     4174 (MCM5)
DNA replication proteins [BR:hsa03032]
 Eukaryotic Type
  DNA Replication Initiation Factors
   pre-RC (pre-replication complex)
    4174 (MCM5)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     4174 (MCM5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MCM MCM_OB MCM_lid MCM_N Mg_chelatase AAA_5 AAA_3 Sigma54_activat
Motif
Other DBs
NCBI-GeneID: 4174
NCBI-ProteinID: NP_006730
OMIM: 602696
HGNC: 6948
Ensembl: ENSG00000100297
Vega: OTTHUMG00000150961
Pharos: P33992(Tbio)
UniProt: P33992 B1AHB0
Position
22q12.3
AA seq 734 aa AA seqDB search
MSGFDDPGIFYSDSFGGDAQADEGQARKSQLQRRFKEFLRQYRVGTDRTGFTFKYRDELK
RHYNLGEYWIEVEMEDLASFDEDLADYLYKQPAEHLQLLEEAAKEVADEVTRPRPSGEEV
LQDIQVMLKSDASPSSIRSLKSDMMSHLVKIPGIIIAASAVRAKATRISIQCRSCRNTLT
NIAMRPGLEGYALPRKCNTDQAGRPKCPLDPYFIMPDKCKCVDFQTLKLQELPDAVPHGE
MPRHMQLYCDRYLCDKVVPGNRVTIMGIYSIKKFGLTTSRGRDRVGVGIRSSYIRVLGIQ
VDTDGSGRSFAGAVSPQEEEEFRRLAALPNVYEVISKSIAPSIFGGTDMKKAIACLLFGG
SRKRLPDGLTRRGDINLLMLGDPGTAKSQLLKFVEKCSPIGVYTSGKGSSAAGLTASVMR
DPSSRNFIMEGGAMVLADGGVVCIDEFDKMREDDRVAIHEAMEQQTISIAKAGITTTLNS
RCSVLAAANSVFGRWDETKGEDNIDFMPTILSRFDMIFIVKDEHNEERDVMLAKHVITLH
VSALTQTQAVEGEIDLAKLKKFIAYCRVKCGPRLSAEAAEKLKNRYIIMRSGARQHERDS
DRRSSIPITVRQLEAIVRIAEALSKMKLQPFATEADVEEALRLFQVSTLDAALSGTLSGV
EGFTSQEDQEMLSRIEKQLKRRFAIGSQVSEHSIIKDFTKQKYPEHAIHKVLQLMLRRGE
IQHRMQRKVLYRLK
NT seq 2205 nt NT seq  +upstreamnt  +downstreamnt
atgtcgggattcgacgatcctggcattttctacagcgacagcttcgggggcgacgcccag
gccgacgaggggcaggcccgcaaatcgcagctgcagaggcgcttcaaggagttcctgcgg
cagtaccgagtgggcaccgaccgcacgggcttcaccttcaaatacagggatgaactcaag
cggcattacaacctgggggagtactggattgaggtggagatggaggatctggccagcttt
gatgaggacctggccgactacttgtacaagcagccagccgagcacctgcagctgctggag
gaagctgccaaggaggtagctgatgaggtgacccggccccggccttctggggaggaggtg
ctccaggacatccaggtcatgctcaagtcggacgccagcccttccagcattcgtagcctg
aagtcggacatgatgtcacacctggtgaagatccctggcatcatcatcgcggcctctgcg
gtccgtgccaaggccacccgcatctctatccagtgccgcagctgccgcaacaccctcacc
aacattgccatgcgccctggcctcgagggctatgccctgcccaggaagtgcaacacagat
caggctgggcgccccaaatgcccattggacccgtacttcatcatgcccgacaaatgcaaa
tgcgtggacttccagaccctgaagctgcaggagctgcctgatgcagtcccccacggggag
atgcccagacacatgcagctctactgcgacaggtacctgtgtgacaaggtcgtccctggg
aacagggttaccatcatgggcatctactccatcaagaagtttggcctgactaccagcagg
ggccgtgacagggtgggcgtgggcatccgaagctcctacatccgtgtcctgggcatccag
gtggacacagatggctctggccgcagctttgctggggccgtgagcccccaggaggaggag
gagttccgtcgcctggctgccctcccaaatgtctatgaggtcatctccaagagcatcgcc
ccctccatctttgggggcacagacatgaagaaggccattgcctgcctgctctttgggggc
tcccgaaagaggctccctgatggacttactcgccgaggagacatcaacctgctgatgcta
ggggaccctgggacagccaagtcccagcttctgaagtttgtggagaagtgttctcccatt
ggggtatacacgtctgggaaaggcagcagcgcagctggactgacagcctcggtgatgagg
gacccttcgtcccggaatttcatcatggagggcggagccatggtcctggccgatggtggg
gtcgtctgtattgacgagtttgacaagatgcgagaagatgaccgtgtggcaatccacgaa
gccatggagcagcagaccatctctatcgccaaggctgggatcaccaccaccctgaactcc
cgctgctccgtcctggctgctgccaactcagtgttcggccgctgggatgagacgaagggg
gaggacaacattgacttcatgcccaccatcttgtcgcgcttcgacatgatcttcatcgtc
aaggatgagcacaatgaggagagggatgtgatgctggccaagcatgtcatcactctgcac
gtgagcgcactgacacagacacaggctgtggagggcgagattgacctggccaagctgaag
aagtttattgcctactgccgagtgaagtgtggcccccggctgtcagcagaggctgcagag
aaactgaagaaccgctacatcatcatgcggagcggggcccgtcagcacgagagggacagt
gaccgccgctccagcatccccatcactgtgcggcagctggaggccattgtgcgcatcgcg
gaagccctcagcaagatgaagctgcagcccttcgccacagaggcagatgtggaggaggcc
ctgcggctcttccaagtgtccacgttggatgctgccttgtccggtaccctgtcaggggtg
gagggcttcaccagccaggaggaccaggagatgctgagccgcatcgagaagcagctcaag
cgccgctttgccattggctcccaggtgtctgagcacagcatcatcaaggacttcaccaag
cagaaatacccggagcacgccatccacaaggtgctgcagctcatgctgcggcgcggcgag
atccagcatcgcatgcagcgcaaggttctctaccgcctcaagtga

DBGET integrated database retrieval system