KEGG   Homo sapiens (human): 4175Help
Entry
4175              CDS       T01001                                 

Gene name
MCM6, MCG40308, Mis5, P105MCM
Definition
(RefSeq) minichromosome maintenance complex component 6
  KO
K02542  DNA replication licensing factor MCM6 [EC:3.6.4.12]
Organism
hsa  Homo sapiens (human)
Pathway
hsa03030  DNA replication
hsa04110  Cell cycle
Module
hsa_M00285  MCM complex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    4175 (MCM6)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    4175 (MCM6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:hsa03032]
    4175 (MCM6)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     4175 (MCM6)
DNA replication proteins [BR:hsa03032]
 Eukaryotic Type
  DNA Replication Initiation Factors
   pre-RC (pre-replication complex)
    4175 (MCM6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MCM MCM_OB MCM6_C MCM_lid MCM_N Mg_chelatase AAA_3 AAA_5 Sigma54_activat
Motif
Other DBs
NCBI-GeneID: 4175
NCBI-ProteinID: NP_005906
OMIM: 601806
HGNC: 6949
Ensembl: ENSG00000076003
Vega: OTTHUMG00000131739
Pharos: Q14566(Tbio)
UniProt: Q14566
Structure
PDB: 

Position
2q21.3
AA seq 821 aa AA seqDB search
MDLAAAAEPGAGSQHLEVRDEVAEKCQKLFLDFLEEFQSSDGEIKYLQLAEELIRPERNT
LVVSFVDLEQFNQQLSTTIQEEFYRVYPYLCRALKTFVKDRKEIPLAKDFYVAFQDLPTR
HKIRELTSSRIGLLTRISGQVVRTHPVHPELVSGTFLCLDCQTVIRDVEQQFKYTQPNIC
RNPVCANRRRFLLDTNKSRFVDFQKVRIQETQAELPRGSIPRSLEVILRAEAVESAQAGD
KCDFTGTLIVVPDVSKLSTPGARAETNSRVSGVDGYETEGIRGLRALGVRDLSYRLVFLA
CCVAPTNPRFGGKELRDEEQTAESIKNQMTVKEWEKVFEMSQDKNLYHNLCTSLFPTIHG
NDEVKRGVLLMLFGGVPKTTGEGTSLRGDINVCIVGDPSTAKSQFLKHVEEFSPRAVYTS
GKASSAAGLTAAVVRDEESHEFVIEAGALMLADNGVCCIDEFDKMDVRDQVAIHEAMEQQ
TISITKAGVKATLNARTSILAAANPISGHYDRSKSLKQNINLSAPIMSRFDLFFILVDEC
NEVTDYAIARRIVDLHSRIEESIDRVYSLDDIRRYLLFARQFKPKISKESEDFIVEQYKH
LRQRDGSGVTKSSWRITVRQLESMIRLSEAMARMHCCDEVQPKHVKEAFRLLNKSIIRVE
TPDVNLDQEEEIQMEVDEGAGGINGHADSPAPVNGINGYNEDINQESAPKASLRLGFSEY
CRISNLIVLHLRKVEEEEDESALKRSELVNWYLKEIESEIDSEEELINKKRIIEKVIHRL
THYDHVLIELTQAGLKGSTEGSESYEEDPYLVVNPNYLLED
NT seq 2466 nt NT seq  +upstreamnt  +downstreamnt
atggacctcgcggcggcagcggagccgggcgccggcagccagcacctggaggtccgcgac
gaggtggccgagaagtgccagaaactgttcctggacttcttggaggagtttcagagcagc
gatggagaaattaaatacttgcaattagcagaggaactgattcgtcctgagagaaacaca
ttggttgtgagttttgtggacctggaacaatttaaccagcaactttccaccaccattcaa
gaggagttctatagagtttacccttacctgtgtcgggccttgaaaacattcgtcaaagac
cgtaaagagatccctcttgccaaggatttttatgttgcattccaagacctgcctaccaga
cacaagattcgagagctcacctcatccagaattggtttgctcactcgcatcagtgggcag
gtggtgcggactcacccagttcacccagagcttgtgagcggaacttttctgtgcttggac
tgtcagacagtgatcagggatgtagaacagcagttcaaatacacacagccaaacatctgc
cgaaatccagtttgtgccaacaggaggagattcttactggatacaaataaatcaagattt
gttgattttcaaaaggttcgtattcaagagacccaagctgagcttcctcgagggagtatc
ccccgcagtttagaagtaattttaagggctgaagctgtggaatcagctcaagctggtgac
aagtgtgactttacagggacactgattgttgtgcctgacgtctccaagcttagcacacca
ggagcacgtgcagaaactaattcccgtgtcagtggtgttgatggatatgagacagaaggc
attcgaggactccgggcccttggtgttagggacctttcttataggctggtctttcttgcc
tgctgtgttgcgccaaccaacccaaggtttggggggaaagagctcagagatgaggaacag
acagctgagagcattaagaaccaaatgactgtgaaagaatgggagaaagtgtttgagatg
agtcaagataaaaatctataccacaatctttgtaccagcctgttccctactatacatggc
aatgatgaagtaaaacggggtgtcctgctgatgctctttggtggcgttccaaagacaaca
ggagaagggacctctcttcgaggggacataaatgtttgcattgttggtgacccaagtaca
gctaagagccaatttctcaagcacgtggaggagttcagccccagagctgtctacaccagt
ggtaaagcgtccagtgctgctggcttaacagcagctgttgtgagagatgaagaatctcat
gagtttgtcattgaggctggagctttgatgttggctgataatggtgtgtgttgtattgat
gaatttgataagatggacgtgcgggatcaagttgctattcatgaagctatggaacagcag
accatatccatcactaaagcaggagtgaaggctactctgaacgcccggacgtccattttg
gcagcagcaaacccaatcagtggacactatgacagatcaaaatcattgaaacagaatata
aatttgtcagctcccatcatgtcccgattcgatctcttctttatccttgtggatgaatgt
aatgaggttacagattatgccattgccaggcgcatagtagatttgcattcaagaattgag
gaatcaattgatcgtgtctattccctcgatgatatcagaagatatcttctctttgcaaga
cagtttaaacccaagatttccaaagagtcagaggacttcattgtggagcaatataaacat
ctccgccagagagatggttctggagtgaccaagtcttcatggaggattacagtgcgacag
cttgagagcatgattcgtctctctgaagctatggctcggatgcactgctgtgatgaggtc
caacctaaacatgtgaaggaagctttccggttactgaataaatcaatcatccgtgtggaa
acacctgatgtcaatctagatcaagaggaagagatccagatggaggtagatgagggtgct
ggtggcatcaatggtcatgctgacagccctgctcctgtgaacgggatcaatggctacaat
gaagacataaatcaagagtctgctcccaaagcctccttaaggctgggcttctctgagtac
tgccgaatctctaaccttattgtgcttcacctcagaaaggtggaagaagaagaggacgag
tcagcattaaagaggagcgagcttgttaactggtacttgaaggaaatcgaatcagagata
gactctgaagaagaacttataaataaaaaaagaatcatagagaaagttattcatcgactc
acacactatgatcatgttctaattgagctcacccaggctggattgaaaggctccacagag
ggaagtgagagctatgaagaagatccctacttggtagttaaccctaactacttgctcgaa
gattga

DBGET integrated database retrieval system