KEGG   Homo sapiens (human): 4176Help
Entry
4176              CDS       T01001                                 

Gene name
MCM7, CDC47, MCM2, P1.1-MCM3, P1CDC47, P85MCM, PNAS146, PPP1R104
Definition
(RefSeq) minichromosome maintenance complex component 7
  KO
K02210  DNA replication licensing factor MCM7 [EC:3.6.4.12]
Organism
hsa  Homo sapiens (human)
Pathway
hsa03030  DNA replication
hsa04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    4176 (MCM7)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    4176 (MCM7)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    4176 (MCM7)
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:hsa03032]
    4176 (MCM7)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     4176 (MCM7)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     4176 (MCM7)
DNA replication proteins [BR:hsa03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   pre-RC (pre-replication complex)
    4176 (MCM7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MCM MCM_OB MCM_N MCM_lid Mg_chelatase AAA_5 MCM_bind AAA_3 Sigma54_activat AAA_lid_2 Mg_chelatase_C
Motif
Other DBs
NCBI-GeneID: 4176
NCBI-ProteinID: NP_005907
OMIM: 600592
HGNC: 6950
Ensembl: ENSG00000166508
Vega: OTTHUMG00000154671
Pharos: P33993(Tbio)
UniProt: P33993 A0A0S2Z4A5 C6EMX8
Position
7q22.1
AA seq 719 aa AA seqDB search
MALKDYALEKEKVKKFLQEFYQDDELGKKQFKYGNQLVRLAHREQVALYVDLDDVAEDDP
ELVDSICENARRYAKLFADAVQELLPQYKEREVVNKDVLDVYIEHRLMMEQRSRDPGMVR
SPQNQYPAELMRRFELYFQGPSSNKPRVIREVRADSVGKLVTVRGIVTRVSEVKPKMVVA
TYTCDQCGAETYQPIQSPTFMPLIMCPSQECQTNRSGGRLYLQTRGSRFIKFQEMKMQEH
SDQVPVGNIPRSITVLVEGENTRIAQPGDHVSVTGIFLPILRTGFRQVVQGLLSETYLEA
HRIVKMNKSEDDESGAGELTREELRQIAEEDFYEKLAASIAPEIYGHEDVKKALLLLLVG
GVDQSPRGMKIRGNINICLMGDPGVAKSQLLSYIDRLAPRSQYTTGRGSSGVGLTAAVLR
DSVSGELTLEGGALVLADQGVCCIDEFDKMAEADRTAIHEVMEQQTISIAKAGILTTLNA
RCSILAAANPAYGRYNPRRSLEQNIQLPAALLSRFDLLWLIQDRPDRDNDLRLAQHITYV
HQHSRQPPSQFEPLDMKLMRRYIAMCREKQPMVPESLADYITAAYVEMRREAWASKDATY
TSARTLLAILRLSTALARLRMVDVVEKEDVNEAIRLMEMSKDSLLGDKGQTARTQRPADV
IFATVRELVSGGRSVRFSEAEQRCVSRGFTPAQFQAALDEYEELNVWQVNASRTRITFV
NT seq 2160 nt NT seq  +upstreamnt  +downstreamnt
atggcactgaaggactacgcgctagagaaggaaaaggttaagaagttcttacaagagttc
taccaggatgatgaactcgggaagaagcagttcaagtatgggaaccagttggttcggctg
gctcatcgggaacaggtggctctgtatgtggacctggacgacgtagccgaggatgacccc
gagttggtggactcaatttgtgagaatgccaggcgctacgcgaagctctttgctgatgcc
gtacaagagctgctgcctcagtacaaggagagggaagtggtaaataaagatgtcctggac
gtttacattgagcatcggctaatgatggagcagcggagtcgggaccctgggatggtccga
agcccccagaaccagtaccctgctgaactcatgcgcagatttgagctgtattttcaaggc
cctagcagcaacaagcctcgtgtgatccgggaagtgcgggctgactctgtggggaagttg
gtaactgtgcgtggaatcgtcactcgtgtctctgaagtcaaacccaagatggtggtggcc
acttacacttgtgaccagtgtggggcagagacctaccagccgatccagtctcccactttc
atgcctctgatcatgtgcccaagccaggagtgccaaaccaaccgctcaggagggcggctg
tatctgcagacacggggctccagattcatcaaattccaggagatgaagatgcaagaacat
agtgatcaggtgcctgtgggaaatatccctcgtagtatcacggtgctggtagaaggagag
aacacaaggattgcccagcctggagaccacgtcagcgtcactggtattttcttgccaatc
ctgcgcactgggttccgacaggtggtacagggtttactctcagaaacctacctggaagcc
catcggattgtgaagatgaacaagagtgaggatgatgagtctggggctggagagctcacc
agggaggagctgaggcaaattgcagaggaggatttctacgaaaagctggcagcttcaatc
gccccagaaatatacgggcatgaagatgtgaagaaggcactgctgctcctgctagtcggg
ggtgtggaccagtctcctcgaggcatgaaaatccggggcaacatcaacatctgtctgatg
ggggatcctggtgtggccaagtctcagctcctgtcatacattgatcgactggcgcctcgc
agccagtacacaacaggccggggctcctcaggagtggggcttacggcagctgtgctgaga
gactccgtgagtggagaactgaccttagagggtggggccctggtgctggctgaccagggt
gtgtgctgcattgatgagttcgacaagatggctgaggccgaccgcacagccatccacgag
gtcatggagcagcagaccatctccattgccaaggccggcattctcaccacactcaatgcc
cgctgctccatcctggctgccgccaaccctgcctacgggcgctacaaccctcgccgcagc
ctggagcagaacatacagctacctgctgcactgctctcccggtttgacctcctctggctg
attcaggaccggcccgaccgagacaatgacctacggttggcccagcacatcacctatgtg
caccagcacagccggcagcccccctcccagtttgaacctctggacatgaagctcatgagg
cgttacatagccatgtgccgcgagaagcagcccatggtgccagagtctctggctgactac
atcacagcagcatacgtggagatgaggcgagaggcttgggctagtaaggatgccacctat
acttctgcccggaccctgctggctatcctgcgcctttccactgctctggcacgtctgaga
atggtggatgtggtggagaaagaagatgtgaatgaagccatcaggctaatggagatgtca
aaggactctcttctaggagacaaggggcagacagctaggactcagagaccagcagatgtg
atatttgccaccgtccgtgaactggtctcagggggccgaagtgtccggttctctgaggca
gagcagcgctgtgtatctcgtggcttcacacccgcccagttccaggcggctctggatgaa
tatgaggagctcaatgtctggcaggtcaatgcttcccggacacggatcacttttgtctga

DBGET integrated database retrieval system