KEGG   Homo sapiens (human): 4184
Entry
4184              CDS       T01001                                 
Symbol
SMCP, HSMCSGEN1, MCS, MCSP
Name
(RefSeq) sperm mitochondria associated cysteine rich protein
Organism
hsa  Homo sapiens (human)
SSDB
Other DBs
NCBI-GeneID: 4184
NCBI-ProteinID: NP_109588
OMIM: 601148
HGNC: 6962
Ensembl: ENSG00000163206
UniProt: P49901 Q5T7P5
Position
1:152878322..152885047
AA seq 116 aa
MCDQTKHSKCCPAKGNQCCPPQQNQCCQSKGNQCCPPKQNQCCQPKGSQCCPPKHNHCCQ
PKPPCCIQARCCGLETKPEVSPLNMESEPNSPQTQDKGCQTQQQPHSPQNESRPSK
NT seq 351 nt   +upstreamnt  +downstreamnt
atgtgtgaccagacaaaacacagtaaatgctgcccagcaaaaggcaatcaatgctgccca
ccacagcagaaccagtgctgccagtcaaaaggcaatcaatgctgcccaccaaaacagaac
cagtgctgccagccaaaaggcagtcaatgctgcccaccaaaacacaatcactgctgccag
ccaaaacccccatgctgcattcaggccaggtgctgtggtttggagaccaagcctgaagtc
tcaccccttaacatggagtctgagcccaactcaccgcaaactcaggacaagggctgtcaa
acccagcagcagccccatagcccacaaaatgagtccaggccaagcaaatga

DBGET integrated database retrieval system