KEGG   Homo sapiens (human): 4193Help
Entry
4193              CDS       T01001                                 

Gene name
MDM2, ACTFS, HDMX, hdm2
Definition
(RefSeq) MDM2 proto-oncogene
  KO
K06643  E3 ubiquitin-protein ligase Mdm2 [EC:2.3.2.27]
Organism
hsa  Homo sapiens (human)
Pathway
hsa01522  Endocrine resistance
hsa01524  Platinum drug resistance
hsa04068  FoxO signaling pathway
hsa04110  Cell cycle
hsa04115  p53 signaling pathway
hsa04120  Ubiquitin mediated proteolysis
hsa04144  Endocytosis
hsa04151  PI3K-Akt signaling pathway
hsa04218  Cellular senescence
hsa04625  C-type lectin receptor signaling pathway
hsa04919  Thyroid hormone signaling pathway
hsa05131  Shigellosis
hsa05163  Human cytomegalovirus infection
hsa05165  Human papillomavirus infection
hsa05169  Epstein-Barr virus infection
hsa05200  Pathways in cancer
hsa05202  Transcriptional misregulation in cancer
hsa05203  Viral carcinogenesis
hsa05205  Proteoglycans in cancer
hsa05206  MicroRNAs in cancer
hsa05214  Glioma
hsa05215  Prostate cancer
hsa05218  Melanoma
hsa05219  Bladder cancer
hsa05220  Chronic myeloid leukemia
Network
nt06130  Cell cycle (viruses)
nt06162  Hepatitis B virus (HBV)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06167  Human cytomegalovirus (HCMV)
nt06170  Influenza A virus (IAV)
nt06230  Cell cycle G1/S
nt06240  Transcription
nt06263  Hepatocellular carcinoma
nt06265  Bladder cancer
nt06266  Non-small cell lung cancer
nt06268  Melanoma
nt06270  Breast cancer
nt06273  Glioma
nt06276  Chronic myeloid leukemia
  Element
N00066  MDM2-p21-Cell cycle G1/S
N00067  Deleted p14(ARF) to p21-cell cycle G1/S
N00068  Amplified MDM2 to p21-cell cycle G1/S
N00076  Mutation-inactivated p14(ARF) to p21-cell cycle G1/S
N00131  Amplified MYCN to transcriptional activation
N00263  EBV EBNA3C to p53-mediated transcription
N00496  MDM2-p21-Cell cycle G1/S
N00536  MDM2-p21-Cell cycle G1/S
Disease
H00025  Penile cancer
H00028  Choriocarcinoma
H00036  Osteosarcoma
H00037  Rhabdomyosarcoma
H00042  Glioma
H01513  Retinoblastoma
H01667  Medulloblastoma
Drug target
Idasanutlin: D11219
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    4193 (MDM2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    4193 (MDM2)
   04151 PI3K-Akt signaling pathway
    4193 (MDM2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    4193 (MDM2)
  09143 Cell growth and death
   04110 Cell cycle
    4193 (MDM2)
   04115 p53 signaling pathway
    4193 (MDM2)
   04218 Cellular senescence
    4193 (MDM2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    4193 (MDM2)
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    4193 (MDM2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    4193 (MDM2)
   05202 Transcriptional misregulation in cancer
    4193 (MDM2)
   05206 MicroRNAs in cancer
    4193 (MDM2)
   05205 Proteoglycans in cancer
    4193 (MDM2)
   05203 Viral carcinogenesis
    4193 (MDM2)
  09162 Cancer: specific types
   05214 Glioma
    4193 (MDM2)
   05220 Chronic myeloid leukemia
    4193 (MDM2)
   05218 Melanoma
    4193 (MDM2)
   05219 Bladder cancer
    4193 (MDM2)
   05215 Prostate cancer
    4193 (MDM2)
  09171 Infectious disease: bacterial
   05131 Shigellosis
    4193 (MDM2)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    4193 (MDM2)
   05169 Epstein-Barr virus infection
    4193 (MDM2)
   05165 Human papillomavirus infection
    4193 (MDM2)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    4193 (MDM2)
   01522 Endocrine resistance
    4193 (MDM2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    4193 (MDM2)
   04121 Ubiquitin system [BR:hsa04121]
    4193 (MDM2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     4193 (MDM2)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    4193 (MDM2)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   MDM2/MDM4 proteins
    4193 (MDM2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-C3HC4_3 zf-RanBP SWIB zf-RING_2 Pinin_SDK_N zf-FPG_IleRS zinc_ribbon_2
Motif
Other DBs
NCBI-GeneID: 4193
NCBI-ProteinID: NP_002383
OMIM: 164785
HGNC: 6973
Ensembl: ENSG00000135679
Vega: OTTHUMG00000142827
Pharos: Q00987(Tchem)
UniProt: Q00987
Structure
PDB: 

Position
12q15
AA seq 497 aa AA seqDB search
MVRSRQMCNTNMSVPTDGAVTTSQIPASEQETLVRPKPLLLKLLKSVGAQKDTYTMKEVL
FYLGQYIMTKRLYDEKQQHIVYCSNDLLGDLFGVPSFSVKEHRKIYTMIYRNLVVVNQQE
SSDSGTSVSENRCHLEGGSDQKDLVQELQEEKPSSSHLVSRPSTSSRRRAISETEENSDE
LSGERQRKRHKSDSISLSFDESLALCVIREICCERSSSSESTGTPSNPDLDAGVSEHSGD
WLDQDSVSDQFSVEFEVESLDSEDYSLSEEGQELSDEDDEVYQVTVYQAGESDTDSFEED
PEISLADYWKCTSCNEMNPPLPSHCNRCWALRENWLPEDKGKDKGEISEKAKLENSTQAE
EGFDVPDCKKTIVNDSRESCVEENDDKITQASQSQESEDYSQPSTSSSIIYSSQEDVKEF
EREETQDKEESVESSLPLNAIEPCVICQGRPKNGCIVHGKTGHLMACFTCAKKLKKRNKP
CPVCRQPIQMIVLTYFP
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atggtgaggagcaggcaaatgtgcaataccaacatgtctgtacctactgatggtgctgta
accacctcacagattccagcttcggaacaagagaccctggttagaccaaagccattgctt
ttgaagttattaaagtctgttggtgcacaaaaagacacttatactatgaaagaggttctt
ttttatcttggccagtatattatgactaaacgattatatgatgagaagcaacaacatatt
gtatattgttcaaatgatcttctaggagatttgtttggcgtgccaagcttctctgtgaaa
gagcacaggaaaatatataccatgatctacaggaacttggtagtagtcaatcagcaggaa
tcatcggactcaggtacatctgtgagtgagaacaggtgtcaccttgaaggtgggagtgat
caaaaggaccttgtacaagagcttcaggaagagaaaccttcatcttcacatttggtttct
agaccatctacctcatctagaaggagagcaattagtgagacagaagaaaattcagatgaa
ttatctggtgaacgacaaagaaaacgccacaaatctgatagtatttccctttcctttgat
gaaagcctggctctgtgtgtaataagggagatatgttgtgaaagaagcagtagcagtgaa
tctacagggacgccatcgaatccggatcttgatgctggtgtaagtgaacattcaggtgat
tggttggatcaggattcagtttcagatcagtttagtgtagaatttgaagttgaatctctc
gactcagaagattatagccttagtgaagaaggacaagaactctcagatgaagatgatgag
gtatatcaagttactgtgtatcaggcaggggagagtgatacagattcatttgaagaagat
cctgaaatttccttagctgactattggaaatgcacttcatgcaatgaaatgaatcccccc
cttccatcacattgcaacagatgttgggcccttcgtgagaattggcttcctgaagataaa
gggaaagataaaggggaaatctctgagaaagccaaactggaaaactcaacacaagctgaa
gagggctttgatgttcctgattgtaaaaaaactatagtgaatgattccagagagtcatgt
gttgaggaaaatgatgataaaattacacaagcttcacaatcacaagaaagtgaagactat
tctcagccatcaacttctagtagcattatttatagcagccaagaagatgtgaaagagttt
gaaagggaagaaacccaagacaaagaagagagtgtggaatctagtttgccccttaatgcc
attgaaccttgtgtgatttgtcaaggtcgacctaaaaatggttgcattgtccatggcaaa
acaggacatcttatggcctgctttacatgtgcaaagaagctaaagaaaaggaataagccc
tgcccagtatgtagacaaccaattcaaatgattgtgctaacttatttcccctag

DBGET integrated database retrieval system