KEGG   Homo sapiens (human): 4194Help
Entry
4194              CDS       T01001                                 

Gene name
MDM4, HDMX, MDMX, MRP1
Definition
(RefSeq) MDM4 regulator of p53
  KO
K10127  protein Mdm4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04115  p53 signaling pathway
hsa05206  MicroRNAs in cancer
Disease
H01513  Retinoblastoma
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    4194 (MDM4)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    4194 (MDM4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    4194 (MDM4)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   MDM2/MDM4 proteins
    4194 (MDM4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-C3HC4_3 zf-RanBP SWIB Prok-RING_4 Cript Cytochrom_c3_2
Motif
Other DBs
NCBI-GeneID: 4194
NCBI-ProteinID: NP_002384
OMIM: 602704
HGNC: 6974
Ensembl: ENSG00000198625
Vega: OTTHUMG00000035877
Pharos: O15151(Tchem)
UniProt: O15151 Q59FS6
Structure
PDB: 

Position
1q32.1
AA seq 490 aa AA seqDB search
MTSFSTSAQCSTSDSACRISPGQINQVRPKLPLLKILHAAGAQGEMFTVKEVMHYLGQYI
MVKQLYDQQEQHMVYCGGDLLGELLGRQSFSVKDPSPLYDMLRKNLVTLATATTDAAQTL
ALAQDHSMDIPSQDQLKQSAEESSTSRKRTTEDDIPTLPTSEHKCIHSREDEDLIENLAQ
DETSRLDLGFEEWDVAGLPWWFLGNLRSNYTPRSNGSTDLQTNQDVGTAIVSDTTDDLWF
LNESVSEQLGVGIKVEAADTEQTSEEVGKVSDKKVIEVGKNDDLEDSKSLSDDTDVEVTS
EDEWQCTECKKFNSPSKRYCFRCWALRKDWYSDCSKLTHSLSTSDITAIPEKENEGNDVP
DCRRTISAPVVRPKDAYIKKENSKLFDPCNSVEFLDLAHSSESQETISSMGEQLDNLSEQ
RTDTENMEDCQNLLKPCSLCEKRPRDGNIIHGRTGHLVTCFHCARRLKKAGASCPICKKE
IQLVIKVFIA
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atgacatcattttccacctctgctcagtgttcaacatctgacagtgcttgcaggatctct
cctggacaaatcaatcaggtacgaccaaaactgccgcttttgaagattttgcatgcagca
ggtgcgcaaggtgaaatgttcactgttaaagaggtcatgcactatttaggtcagtacata
atggtgaagcaactttatgatcagcaggagcagcatatggtatattgtggtggagatctt
ttgggagaactactgggacgtcagagcttctccgtgaaagacccaagccctctctatgat
atgctaagaaagaatcttgtcactttagccactgctactacagatgctgctcagactctc
gctctcgcacaggatcacagtatggatattccaagtcaagaccaactgaagcaaagtgca
gaggaaagttccacttccagaaaaagaactacagaagacgatatccccacactgcctacc
tcagagcataaatgcatacattctagagaagatgaagacttaattgaaaatttagcccaa
gatgaaacatctaggctggaccttggatttgaggagtgggatgtagctggcctgccttgg
tggtttttaggaaacttgagaagcaactatacacctagaagtaatggctcaactgattta
cagacaaatcaggatgtgggtactgccattgtttcagatactacagatgacttgtggttt
ttgaatgagtcagtatcagagcagttaggtgttggaataaaagttgaagctgctgatact
gaacaaacaagtgaagaagtagggaaagtaagtgacaaaaaggtgattgaagtgggaaaa
aatgatgacctggaggactctaagtccttaagtgatgataccgatgtagaggttacctct
gaggatgagtggcagtgtactgaatgcaagaaatttaactctccaagcaagaggtactgt
tttcgttgttgggccttgaggaaggattggtattcagattgttcaaagttaacccattct
ctctccacgtctgatatcactgccatacctgaaaaggaaaatgaaggaaatgatgtccct
gattgtcgaagaaccatttcggctcctgtcgttagacctaaagatgcgtatataaagaaa
gaaaactccaaactttttgatccctgcaactcagtggaattcttggatttggctcacagt
tctgaaagccaagagaccatctcaagcatgggagaacagttagataacctttctgaacag
agaacagatacagaaaacatggaggattgccagaatctcttgaagccatgtagcttatgt
gagaaaagaccacgagacgggaacattattcatggaaggacgggccatcttgtcacttgt
tttcactgtgccagaagactaaagaaggctggggcttcatgccctatttgcaagaaagag
attcagctggttattaaggtttttatagcataa

DBGET integrated database retrieval system