KEGG   Homo sapiens (human): 420Help
Entry
420               CDS       T01001                                 

Gene name
ART4, ARTC4, CD297, DO, DO/ART4, DOK1
Definition
(RefSeq) ADP-ribosyltransferase 4 (Dombrock blood group)
  KO
K06717  ADP-ribosyltransferase 4 [EC:2.4.2.31]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hsa04090]
    420 (ART4)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
    420 (ART4)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     420 (ART4)
CD molecules [BR:hsa04090]
 Proteins
  420 (ART4)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
 Enzymes
  420 (ART4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ART ADPrib_exo_Tox
Motif
Other DBs
NCBI-GeneID: 420
NCBI-ProteinID: NP_066549
OMIM: 110600
HGNC: 726
Ensembl: ENSG00000111339
Vega: OTTHUMG00000168738
Pharos: Q93070(Tbio)
UniProt: Q93070
Position
12p12.3
AA seq 314 aa AA seqDB search
MGPLINRCKKILLPTTVPPATMRIWLLGGLLPFLLLLSGLQRPTEGSEVAIKIDFDFAPG
SFDDQYQGCSKQVMEKLTQGDYFTKDIEAQKNYFRMWQKAHLAWLNQGKVLPQNMTTTHA
VAILFYTLNSNVHSDFTRAMASVARTPQQYERSFHFKYLHYYLTSAIQLLRKDSIMENGT
LCYEVHYRTKDVHFNAYTGATIRFGQFLSTSLLKEEAQEFGNQTLFTIFTCLGAPVQYFS
LKKEVLIPPYELFKVINMSYHPRGDWLQLRSTGNLSTYNCQLLKASSKKCIPDPIAIASL
SFLTSVIIFSKSRV
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgggtccattgatcaacagatgcaagaagattcttctcccaactactgtacctcctgca
acgatgagaatctggctccttggaggcctgctgccattcctgctgctcctctctggcctg
cagagacccacagagggttctgaggttgcaattaaaatcgacttcgacttcgcaccaggt
tcttttgatgatcagtaccaaggctgtagcaaacaggttatggagaaactaactcaaggg
gattatttcacaaaagacatagaagcccagaagaattattttaggatgtggcaaaaagcc
cacttagcctggcttaaccaaggaaaagttctaccccagaacatgactaccacacacgct
gtggctattttgttttatacattgaacagcaatgttcattctgactttactagagccatg
gcctctgttgccaggactccacagcagtatgaacgttcattccacttcaaatatttacac
tactacctcacctcagcaatccagctgctgaggaaagacagcatcatggagaatggcact
ctgtgctatgaggtgcattataggacgaaggatgtccactttaatgcctacacaggggcc
accattcgatttggccaattcctctccacatccctcctgaaagaagaggcacaggagttt
gggaaccagacactatttaccatattcacctgcctgggtgcacctgtacagtacttctcc
ctcaagaaggaagtcttgatccctccctatgagctgtttaaagttataaatatgagctac
cacccaagaggagactggttgcagttgaggtcaactgggaacctgagcacatataactgt
cagctgctaaaagcttccagcaagaaatgcatccctgatcctatagctattgcatctctc
tcctttttgaccagtgtcatcatcttttccaaaagcagagtataa

DBGET integrated database retrieval system