KEGG   Homo sapiens (human): 4205Help
Entry
4205              CDS       T01001                                 

Gene name
MEF2A, ADCAD1, RSRFC4, RSRFC9, mef2
Definition
(RefSeq) myocyte enhancer factor 2A
  KO
K09260  MADS-box transcription enhancer factor 2A
Organism
hsa  Homo sapiens (human)
Pathway
hsa04022  cGMP-PKG signaling pathway
hsa04371  Apelin signaling pathway
hsa04928  Parathyroid hormone synthesis, secretion and action
hsa05418  Fluid shear stress and atherosclerosis
Disease
H01742  Coronary artery disease
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    4205 (MEF2A)
   04022 cGMP-PKG signaling pathway
    4205 (MEF2A)
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    4205 (MEF2A)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    4205 (MEF2A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    4205 (MEF2A)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   MADS-box regulators of differentiation, MEF-2
    4205 (MEF2A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SRF-TF HJURP_C GHD
Motif
Other DBs
NCBI-GeneID: 4205
NCBI-ProteinID: NP_001306135
OMIM: 600660
HGNC: 6993
Ensembl: ENSG00000068305
Vega: OTTHUMG00000171937
Pharos: Q02078(Tbio)
UniProt: Q02078 A0A0S2Z4N0
Structure
PDB: 

Position
15q26.3
AA seq 505 aa AA seqDB search
MGRKKIQITRIMDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNSSNKLFQYAST
DMDKVLLKYTEYNEPHESRTNSDIVETLRKKGLNGCESPDADDYFEHSPLSEDRFSKLNE
DSDFIFKRGPPGLPPQNFSMSVTVPVTSPNALSYTNPGSSLVSPSLAASSTLTDSSMLSP
PQTTLHRNVSPGAPQRPPSTGNAGGMLSTTDLTVPNGAGSSPVGNGFVNSRASPNLIGAT
GANSLGKVMPTKSPPPPGGGNLGMNSRKPDLRVVIPPSSKGMMPPLSEEEELELNTQRIS
SSQATQPLATPVVSVTTPSLPPQGLVYSAMPTAYNTDYSLTSADLSALQGFNSPGMLSLG
QVSAWQQHHLGQAALSSLVAGGQLSQGSNLSINTNQNISIKSEPISPPRDRMTPSGFQQQ
QQQQQQQQPPPPPQPQPQPPQPQPRQEMGRSPVDSLSSSSSSYDGSDREDPRGDFHSPIV
LGRPPNTEDRESPSVKRMRMDAWVT
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atggggcggaagaaaatacaaatcacacgcataatggatgaaaggaaccgacaggtcact
tttacaaagagaaagtttggattaatgaagaaagcctatgaacttagtgtgctctgtgac
tgtgaaatagcactcatcattttcaacagctctaacaaactgtttcaatatgctagcact
gatatggacaaagttcttctcaagtatacagaatataatgaacctcatgaaagcagaacc
aactcggatattgttgagactttaagaaagaaaggccttaatggttgtgagagccctgat
gctgacgattactttgagcacagtccactctcggaggacagattcagcaaactaaatgaa
gatagtgattttattttcaaacgaggccctcctggtctgccacctcagaacttttcaatg
tctgtcacagttccagtgaccagccccaatgctttgtcctacactaacccagggagttca
ctggtgtccccatctttggcagccagctcaacgttaacagattcaagcatgctctctcca
cctcaaaccacattacatagaaatgtgtctcctggagctcctcagagaccaccaagtact
ggcaatgcaggtgggatgttgagcactacagacctcacagtgccaaatggagctggaagc
agtccagtggggaatggatttgtaaactcaagagcttctccaaatttgattggagctact
ggtgcaaatagcttaggcaaagtcatgcctacaaagtctccccctccaccaggtggtggt
aatcttggaatgaacagtaggaaaccagatcttcgagttgtcatccccccttcaagcaag
ggcatgatgcctccactatcggaggaagaggaattggagttgaatacccagaggatcagt
agttctcaagccactcaacctcttgctaccccagtcgtgtctgtgacaaccccaagcttg
cctccgcaaggacttgtgtactcagcaatgccgactgcctacaacactgattattcactg
accagcgctgacctgtcagcccttcaaggcttcaactcgccaggaatgctgtcgctggga
caggtgtcggcctggcagcagcaccacctaggacaagcagccctcagctctcttgttgct
ggagggcagttatctcagggttccaatttatccattaataccaaccaaaacatcagcatc
aagtccgaaccgatttcacctcctcgggatcgtatgaccccatcgggcttccagcagcag
cagcagcagcagcagcagcagcagccgccgccaccaccgcagccccagccacaacccccg
cagccccagccccgacaggaaatggggcgctcccctgtggacagtctgagcagctctagt
agctcctatgatggcagtgatcgggaggatccacggggcgacttccattctccaattgtg
cttggccgacccccaaacactgaggacagagaaagcccttctgtaaagcgaatgaggatg
gacgcgtgggtgacctaa

DBGET integrated database retrieval system