KEGG   Homo sapiens (human): 4209Help
Entry
4209              CDS       T01001                                 

Gene name
MEF2D
Definition
(RefSeq) myocyte enhancer factor 2D
  KO
K09262  MADS-box transcription enhancer factor 2D
Organism
hsa  Homo sapiens (human)
Pathway
hsa04022  cGMP-PKG signaling pathway
hsa04371  Apelin signaling pathway
hsa04928  Parathyroid hormone synthesis, secretion and action
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    4209 (MEF2D)
   04022 cGMP-PKG signaling pathway
    4209 (MEF2D)
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    4209 (MEF2D)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    4209 (MEF2D)
   04131 Membrane trafficking [BR:hsa04131]
    4209 (MEF2D)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  beta-Scaffold factors with minor groove contacts
   MADS-box regulators of differentiation, MEF-2
    4209 (MEF2D)
Membrane trafficking [BR:hsa04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    4209 (MEF2D)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SRF-TF HJURP_C CCDC53 TFIIA
Motif
Other DBs
NCBI-GeneID: 4209
NCBI-ProteinID: NP_005911
OMIM: 600663
HGNC: 6997
Ensembl: ENSG00000116604
Vega: OTTHUMG00000033095
Pharos: Q14814(Tbio)
UniProt: Q14814
Position
1q22
AA seq 521 aa AA seqDB search
MGRKKIQIQRITDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNHSNKLFQYAST
DMDKVLLKYTEYNEPHESRTNADIIETLRKKGFNGCDSPEPDGEDSLEQSPLLEDKYRRA
SEELDGLFRRYGSTVPAPNFAMPVTVPVSNQSSLQFSNPSGSLVTPSLVTSSLTDPRLLS
PQQPALQRNSVSPGLPQRPASAGAMLGGDLNSANGACPSPVGNGYVSARASPGLLPVANG
NSLNKVIPAKSPPPPTHSTQLGAPSRKPDLRVITSQAGKGLMHHLTEDHLDLNNAQRLGV
SQSTHSLTTPVVSVATPSLLSQGLPFSSMPTAYNTDYQLTSAELSSLPAFSSPGGLSLGN
VTAWQQPQQPQQPQQPQPPQQQPPQPQQPQPQQPQQPQQPPQQQSHLVPVSLSNLIPGSP
LPHVGAALTVTTHPHISIKSEPVSPSRERSPAPPPPAVFPAARPEPGDGLSSPAGGSYET
GDRDDGRGDFGPTLGLLRPAPEPEAEGSAVKRMRLDTWTLK
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atggggaggaaaaagattcagatccagcgaatcaccgacgagcggaaccgacaggtgact
ttcaccaagcggaagtttggcctgatgaagaaggcgtatgagctgagcgtgctatgtgac
tgcgagatcgcactcatcatcttcaaccactccaacaagctgttccagtacgccagcacc
gacatggacaaggtgctgctcaagtacacggagtacaatgagccacacgagagccgcacc
aacgccgacatcatcgagaccctgaggaagaagggcttcaacggctgcgacagccccgag
cccgacggggaggactcgctggaacagagccccctgctggaggacaagtaccgacgcgcc
agcgaggagctcgacgggctcttccggcgctatgggtcaactgtcccggcccccaacttt
gccatgcctgtcacggtgcccgtgtccaatcagagctcactgcagttcagcaatcccagc
ggctccctggtcaccccttccctggtgacatcatccctcacggacccgcggctcctgtcc
ccccagcagccagcactacagaggaacagtgtgtctcctggcctgccccagcggccagct
agtgcgggggccatgctggggggtgacctgaacagtgctaacggagcctgccccagccct
gttgggaatggctacgtcagtgctcgggcttcccctggcctcctccctgtggccaatggc
aacagcctaaacaaggtcatccctgccaagtctccacccccacctacccacagcacccag
cttggagcccccagccgcaagcccgacctgcgagtcatcacttcccaggcaggaaagggg
ttaatgcatcacttgactgaggaccatttagatctgaacaatgcccagcgccttggggtc
tcccagtctactcattcgctcaccaccccagtggtttctgtggcaacgccgagtttactc
agccagggcctccccttctcttccatgcccactgcctacaacacagattaccagttgacc
agtgcagagctctcctccttaccagcctttagttcacctggggggctgtcgctaggcaat
gtcactgcctggcaacagccacagcagccccagcagccgcagcagccacagcctccacag
cagcagccaccgcagccacagcagccacagccacagcagcctcagcagccgcaacagcca
cctcagcaacagtcccacctggtccctgtatctctcagcaacctcatcccgggcagcccc
ctgccccacgtgggtgctgccctcacagtcaccacccacccccacatcagcatcaagtca
gaaccggtgtccccaagccgtgagcgcagccctgcgcctccccctccagctgtgttccca
gctgcccgccctgagcctggcgatggtctcagcagcccagccgggggatcctatgagacg
ggagaccgggatgacggacggggggacttcgggcccacactgggcctgctgcgcccagcc
ccagagcctgaggctgagggctcagctgtgaagaggatgcggcttgatacctggacatta
aagtga

DBGET integrated database retrieval system