KEGG   Homo sapiens (human): 4215Help
Entry
4215              CDS       T01001                                 

Gene name
MAP3K3, MAPKKK3, MEKK3
Definition
(RefSeq) mitogen-activated protein kinase kinase kinase 3
  KO
K04421  mitogen-activated protein kinase kinase kinase 3 [EC:2.7.11.25]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04722  Neurotrophin signaling pathway
hsa04912  GnRH signaling pathway
hsa05166  Human T-cell leukemia virus 1 infection
hsa05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    4215 (MAP3K3)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    4215 (MAP3K3)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    4215 (MAP3K3)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    4215 (MAP3K3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    4215 (MAP3K3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    4215 (MAP3K3)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     4215 (MAP3K3)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: STE group
  STE11 family
   4215 (MAP3K3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PB1 Kinase-like FTA2
Motif
Other DBs
NCBI-GeneID: 4215
NCBI-ProteinID: NP_002392
OMIM: 602539
HGNC: 6855
Ensembl: ENSG00000198909
Vega: OTTHUMG00000178905
Pharos: Q99759(Tchem)
UniProt: Q99759
Structure
PDB: 

Position
17q23.3
AA seq 626 aa AA seqDB search
MDEQEALNSIMNDLVALQMNRRHRMPGYETMKNKDTGHSNRQSDVRIKFEHNGERRIIAF
SRPVKYEDVEHKVTTVFGQPLDLHYMNNELSILLKNQDDLDKAIDILDRSSSMKSLRILL
LSQDRNHNSSSPHSGVSRQVRIKASQSAGDINTIYQPPEPRSRHLSVSSQNPGRSSPPPG
YVPERQQHIARQGSYTSINSEGEFIPETSEQCMLDPLSSAENSLSGSCQSLDRSADSPSF
RKSRMSRAQSFPDNRQEYSDRETQLYDKGVKGGTYPRRYHVSVHHKDYSDGRRTFPRIRR
HQGNLFTLVPSSRSLSTNGENMGLAVQYLDPRGRLRSADSENALSVQERNVPTKSPSAPI
NWRRGKLLGQGAFGRVYLCYDVDTGRELASKQVQFDPDSPETSKEVSALECEIQLLKNLQ
HERIVQYYGCLRDRAEKTLTIFMEYMPGGSVKDQLKAYGALTESVTRKYTRQILEGMSYL
HSNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTICMSGTGMRSVTGTPYWMSPEVIS
GEGYGRKADVWSLGCTVVEMLTEKPPWAEYEAMAAIFKIATQPTNPQLPSHISEHGRDFL
RRIFVEARQRPSAEELLTHHFAQLMY
NT seq 1881 nt NT seq  +upstreamnt  +downstreamnt
atggacgaacaggaggcattgaactcaatcatgaacgatctggtggccctccagatgaac
cgacgtcaccggatgcctggatatgagaccatgaagaacaaagacacaggtcactcaaat
aggcagagtgacgtcagaatcaagttcgagcacaacggggagaggcgaattatagcgttc
agccggcctgtgaaatatgaagatgtggagcacaaggtgacaacagtatttggacaacct
cttgatctacattacatgaacaatgagctctccatcctgctgaaaaaccaagatgatctt
gataaagcaattgacattttagatagaagctcaagcatgaaaagccttaggatattgctg
ttgtcccaggacagaaaccataacagttcctctccccactctggggtgtccagacaggtg
cggatcaaggcttcccagtccgcaggggatataaatactatctaccagccccccgagccc
agaagcaggcacctctctgtcagctcccagaaccctggccgaagctcacctccccctggc
tatgttcctgagcggcagcagcacattgcccggcaggggtcctacaccagcatcaacagt
gagggggagttcatcccagagaccagcgagcagtgcatgctggatcccctgagcagtgca
gaaaattccttgtctggaagctgccaatccttggacaggtcagcagacagcccatccttc
cggaaatcacgaatgtcccgtgcccagagcttccctgacaacagacaggaatactcagat
cgggaaactcagctttatgacaaaggggtcaaaggtggaacctacccccggcgctaccac
gtgtctgtgcaccacaaggactacagtgatggcagaagaacatttccccgaatacggcgt
catcaaggcaacttgttcaccctggtgccctccagccgctccctgagcacaaatggcgag
aacatgggtctggctgtgcaatacctggacccccgtgggcgcctgcggagtgcggacagc
gagaatgccctctctgtgcaggagaggaatgtgccaaccaagtctcccagtgcccccatc
aactggcgccggggaaagctcctgggccagggtgccttcggcagggtctatttgtgctat
gacgtggacacgggacgtgaacttgcttccaagcaggtccaatttgatccagacagtcct
gagacaagcaaggaggtgagtgctctggagtgcgagatccagttgctaaagaacttgcag
catgagcgcatcgtgcagtactatggctgtctgcgggaccgcgctgagaagaccctgacc
atcttcatggagtacatgccagggggctcggtgaaagaccagttgaaggcttacggtgct
ctgacagagagcgtgacccgaaagtacacgcggcagatcctggagggcatgtcctacctg
cacagcaacatgattgttcaccgggacattaagggagccaacatcctccgagactctgct
gggaatgtaaagctgggggactttggggccagcaaacgcctgcagacgatctgtatgtcg
gggacgggcatgcgctccgtcactggcacaccctactggatgagccctgaggtgatcagc
ggcgagggctatggaaggaaagcagacgtgtggagcctgggctgcactgtggtggagatg
ctgacagagaaaccaccgtgggcagagtatgaagctatggccgccatcttcaagattgcc
acccagcccaccaatcctcagctgccctcccacatctctgaacatggccgggacttcctg
aggcgcatttttgtggaggctcgccagagaccttcagctgaggagctgctcacacaccac
tttgcacagctcatgtactga

DBGET integrated database retrieval system